CAZyme Information: OTA25321.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA25321.1
• CAZy Family: GH105
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1Z5SWX5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242	MUNK01000207|CGC1	25913.13	10.9501

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000207:80965-81767(-)

Full Sequence      

MANFRYLIIALCLAALAASKSINNGMRLKILPLGASIVWGQNSADGNGFRGGLRKALIAG
GNKYVSMVGTVRHGNMAFNACEGFPGQVIQSVANKALEHHVYTDYYPNVILIHVGTNDCW
AGSSASTMAGRITWMLNSIKTRQPRTFVLLSTLIPSRNANQEACIRRFNAALPGVVAAAK
RGGQKVALVDMHAVVPVREISGDGTHPTNAGYQLMAKAWYRAMVKHAGMISAPNPKGRAA
PR

Enzyme Prediction     

No EC number prediction in OTA25321.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	28	222	1.6e-49	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.95e-42	28	223	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	1.14e-17	30	222	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	8.49e-16	33	214	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238858	PAF_acetylesterase_like	3.65e-10	107	221	90	208	PAF_acetylhydrolase (PAF-AH)_like subfamily of SGNH-hydrolases. Platelet-activating factor (PAF) and PAF-AH are key players in inflammation and in atherosclerosis. PAF-AH is a calcium independent phospholipase A2 which exhibits strong substrate specificity towards PAF, hydrolyzing an acetyl ester at the sn-2 position. PAF-AH also degrades a family of oxidized PAF-like phospholipids with short sn-2 residues. In addition, PAF and PAF-AH are associated with neural migration and mammalian reproduction.
238872	SGNH_hydrolase_like_2	2.46e-08	104	222	59	191	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO66483.1|CE0	1.06e-38	15	234	30	251
CCD55162.2|CE3	5.74e-37	21	233	44	253
ATZ53308.1|CE3	5.74e-37	21	233	44	253
CAP71774.1|CE3	3.00e-36	18	234	50	270
CDP31165.1|CE3	3.00e-36	18	234	50	270

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B5L_A	1.04e-06	107	216	82	192	Crystal structure of acetyl esterase mutant S10A with acetate ion [Talaromyces cellulolyticus]
5B5S_A	1.04e-06	107	216	82	192	Crystal structure of a carbohydrate esterase family 3 from Talaromyces cellulolyticus [Talaromyces cellulolyticus]

Swiss-Prot Hits     

OTA25321.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000195	0.999797	CS pos: 19-20. Pr: 0.9710

TMHMM  Annotations     

There is no transmembrane helices in OTA25321.1.