CAZyme Information: OTA24612.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA24612.1
• CAZy Family: CE5
• CAZyme Description: Rhamnogalacturonan endolyase [Source:UniProtKB/TrEMBL;Acc:A0A1Z5SUX9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
663		75399.09	5.0267

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000237:63441-67229(-)

Full Sequence      

MPQQPITVHDLQAAQLHQKVDLLIENLVNIKDTTGKFLLRLEDGRVIDTKGWNDWEWTHG
IGLYGLWQYHFLTGSEKALQTATGWFREQLAIGTTKNINTMSPFLTLAYLHERTGEPSYL
PWLDSWAEWAMYDLTRTPFGGMQHVTYAADNTNELWDDTLMMTVLPLAKIGKLLNRPHYI
EEAKRQFLLHIKYLFDPTTGLFFHGWKFDNSAEGGFGHNFARARWARGNSWLTIVIPDFI
ELLDLPANDGLRIHLIDTLEAQCQALKRLQADNGMWRTILDKPQSEGSYEEASATAGFAY
GMLKAARKRYIDRSYEDVALKAVKAVMERISDDGELRESSNHHGNQVPNITNGFDRTFGP
QYYHFNKGSSDATLQDLRQDALQYASPTWNVDFYDSIAPHVPNYVPSSGRGSWEGKIKLP
HGAGHPIAVLSQNGVDFQDNVFDTEAYQYWADVDEHTGKVIIPRVKADTYRLTVYAEGIF
GQYVQDDVVVEAGETSKTKVHWREESAGTELWRIGTPDKSTGEYRHGYELDPTHPLHPEE
YCIYWGAYDYHEDFPEGVTFRVGESDVGDDLNYIHWSVYGGKGSLREDPYYGDGDVNNWT
VLFDVAKHALHKKTEATLTVQLSGAKTAAGNTDVFNASEPYIDLPYTVVINGYEQPSWII
PWN

Enzyme Prediction     

EC	-	4.2.2.23:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL4	339	663	5.5e-156	0.509493670886076
GH105	50	346	6e-96	0.8825301204819277

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	8.99e-96	25	336	6	310	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	6.13e-86	29	336	1	299	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
199904	RGL4_M	1.41e-30	409	499	1	90	Middle domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle domain represented by this model and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
405387	fn3_3	8.55e-23	422	495	3	72	Polysaccharide lyase family 4, domain II. FnIII-like is domain II of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain displays an immunoglobulin-like or more specifically Fibronectin-III type fold and shows highest structural similarity to the C-terminal beta-sandwich subdomain of the pro-hormone/propeptide processing enzyme carboxypeptidase gp180 from duck. It serves to assist in producing the deep pocket, with domain III, into which the substrate fits.
199905	RGL4_C	1.04e-14	512	635	1	91	C-terminal domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS76750.1|GH105	1.47e-188	1	340	1	340
UJO23795.1|GH105	5.95e-188	1	340	1	340
SMR63772.1|GH105	1.05e-170	1	340	1	340
SMQ55448.1|GH105	1.05e-170	1	340	1	340
SMR60657.1|GH105	1.05e-170	1	340	1	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	1.17e-147	13	340	5	334	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	8.54e-133	9	340	19	342	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	3.55e-129	14	340	25	343	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U5P7|RGLC_ASPOR	6.01e-123	340	662	276	596	Probable rhamnogalacturonate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rglC PE=3 SV=1
sp|A1D144|RGLB_NEOFI	7.20e-121	340	663	271	592	Probable rhamnogalacturonate lyase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=rglB PE=3 SV=1
sp|A5ABH4|RGLB_ASPNC	1.36e-120	340	660	276	593	Probable rhamnogalacturonate lyase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rglB PE=3 SV=1
sp|Q4WR79|RGLB_ASPFU	6.13e-119	340	663	271	592	Probable rhamnogalacturonate lyase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=rglB PE=3 SV=1
sp|B0XPA2|RGLB_ASPFC	6.13e-119	340	663	271	592	Probable rhamnogalacturonate lyase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=rglB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000075	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OTA24612.1.