CAZyme Information: OTA24467.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA24467.1
• CAZy Family: CE3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
764	MUNK01000242|CGC2	84473.66	4.2059

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000242:58607-60956(+)

Full Sequence      

MGFPSSLSLALGGLGLPLLAASSPIHSTAENSQLDLGNGFALEWSGNSIEITQGNQDIWS
AVTPFISASAGNDSVSGSNGAFNITEVDYDLCADQSVEAVQHVPWNLSTTGEAIEVSGQL
LECGDTSTPYSLTLWVPSDLPEHIAFYIDVSQRAMSEPLKKLYFSYSSQASEDIYGLGGQ
ASFASLKNQSVPIFTREQGVGRGDEPITSIENANGSFAGGNKFTTYTAIPSYITTEGNVF
YLSEKSSAYANFDFTKPDEITMRYDSLSVDGAIAKGKDMFEAVERLTEATGRMPALPSWV
DNGAILGIQGGQSKVNRIVQEGLNISCPIAGVWLQDWEGTHTQAGPYLNISRLWWNWEND
EVLYPEWNEFVQDLRSQYNVRTLSYMNVFLTNVSTKEDGYRRNLYNEATELGYFVQNTTT
DSPAVISSGPGLEAGIIDITNPDLREWFKDVLRTQVWNANISGYMSDFGEYTPVTSDTSL
QNMVSDAFFFHNKYPLLWAEFQRSVIEEFGLEDEALIFHRSANTGANRYMNLFWVGDQNL
NWGANDGIKSVVTIMGHMGFSGYAQQHSDVSGYTDTLTYQGYNVTRSAELLGRWGELAAV
SSPVFRSHEGNIPEVNAQFYSNASTYGYYAYNARMFVSLAAYRRSVLDNECRAKGWPLLR
PPVMYHTADARAREISYQSYYLGPDLYVAPVLDPETFKVSVYLPGNGMFTHVWSGEVYNG
GQEVTVPAPYGQPAVFIVDGAETPELEPFLEFVREENGTKITVE

Enzyme Prediction     

No EC number prediction in OTA24467.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	275	741	1.6e-67	0.9836065573770492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236691	PRK10426	1.36e-175	161	746	71	626	alpha-glucosidase; Provisional
269880	GH31_glucosidase_YihQ	3.60e-158	291	633	1	325	alpha-glucosidase YihQ-like. YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride. Orthologs of YihQ that have not yet been functionally characterized are present in plants and fungi. YihQ has sequence similarity to other GH31 enzymes such as CtsZ, a 6-alpha-glucosyltransferase from Bacillus globisporus, and YicI, an alpha-xylosidase from Echerichia coli. These latter two belong to different GH31 subfamilies than YihQ. In bacteria, YihQ (along with YihO) is important for bacterial O-antigen capsule assembly and translocation.
224418	YicI	6.42e-70	162	760	145	687	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	7.12e-47	276	741	5	440	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269878	GH31_NET37	1.46e-24	356	705	49	361	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO15759.1|GH31	0.0	1	764	1	768
USW53386.1|GH31	0.0	20	763	17	767
SMR41549.1|GH31	0.0	19	764	17	766
SMR43741.1|GH31	0.0	19	764	17	766
SMQ45186.1|GH31	0.0	19	764	17	766

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PNR_A	1.86e-100	148	761	90	669	Chain A, Alpha-glucosidase [[Eubacterium] rectale],6PNR_C Chain C, Alpha-glucosidase [[Eubacterium] rectale]
5AED_A	9.97e-98	161	755	116	680	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AED_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEG_A A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5AEG_B A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5OHT_A A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12],5OHT_B A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12]
5AEE_A	5.32e-97	161	755	116	680	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEE_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12]
5OHY_A	1.83e-89	154	736	92	646	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]
5OHS_A	9.67e-89	154	736	92	646	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_E Chain E, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_F Chain F, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_G Chain G, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_H Chain H, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_A Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32138|SQASE_ECOLI	1.15e-96	161	736	116	661	Sulfoquinovosidase OS=Escherichia coli (strain K12) OX=83333 GN=yihQ PE=1 SV=3
sp|P31434|XYLS_ECOLI	1.15e-19	172	720	160	646	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
sp|Q69ZQ1|MYORG_MOUSE	1.56e-14	360	719	365	693	Myogenesis-regulating glycosidase OS=Mus musculus OX=10090 GN=Myorg PE=1 SV=2
sp|Q6NSJ0|MYORG_HUMAN	6.20e-14	283	719	297	691	Myogenesis-regulating glycosidase OS=Homo sapiens OX=9606 GN=MYORG PE=1 SV=2
sp|A2QTU5|XYLA_ASPNC	3.32e-13	164	742	157	728	Alpha-xylosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axlA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000249	0.999721	CS pos: 22-23. Pr: 0.8448

TMHMM  Annotations     

There is no transmembrane helices in OTA24467.1.