CAZyme Information: OTA24070.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA24070.1
• CAZy Family: CE1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
432	MUNK01000261|CGC1	48173.61	4.9120

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000261:55625-57005(-)

Full Sequence      

MNGSGVLFALAAYIVLTYATILQNGQVRPTDYPNTAIPAISGYNSTWRTYPPSAEELSYK
GRWDDKHISWWSAPGLKFGFQADFLAISFGNYTSEDVLIAYRLDGLDWMLTNVTTSSTHL
LISPETTGFNLTTSGNGTSGNLTEAYRTFEMRVTNWAYGVQIQNVHVAGGAGRLVRIPDY
TRRMELIGDSLSAGQYATLEGISSYSWGLMYGLGNTEFSVTAYPGICLHDSQCYGNVHGQ
ELQWLKVPDTSYRAYQIYGEDPDNIPNWNFSAHPAADITVINLGTNDHNPTNNITAPEFR
TSYINLVASILSRWPSTQIIVVSLWIGFTQVGSTYTEDGGLDAELQHVVRHFNNGSLNTR
GECAACSVYYFNSTGILQHNDLGPLYHPTDVGHVKLASHLMMYIKWVFGWEFEQSGPEVQ
HETLYWNDQTSY

Enzyme Prediction     

No EC number prediction in OTA24070.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	183	404	5.8e-18	0.9952153110047847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	1.25e-30	183	405	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
238141	SGNH_hydrolase	2.26e-09	186	400	3	184	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	1.38e-06	186	393	1	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
395531	Lipase_GDSL	0.008	275	400	78	224	GDSL-like Lipase/Acylhydrolase.
238871	XynB_like	0.009	255	397	23	150	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO21504.1|CE0	1.07e-182	16	428	14	417
AEO54717.1|CE0	7.63e-159	19	432	20	433
CDP24093.1|CE0	9.09e-156	19	432	20	436
VBB73265.1|CE0	3.67e-155	19	432	20	436
APA11901.1|CE0	7.41e-151	19	432	19	430

PDB Hits     

OTA24070.1 has no PDB hit.

Swiss-Prot Hits     

OTA24070.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.054412	0.945545	CS pos: 24-25. Pr: 0.5088

TMHMM  Annotations     

Start	End
5	22