CAZyme Information: OTA23999.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA23999.1
• CAZy Family: CBM63
• CAZyme Description: Glyco_trans_2-like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1Z5ST42]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
558		62486.78	5.4265

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000265:21-1933(-)

Full Sequence      

MGLLSYVKPGKASKDKKDATPSHAEPELTEKPATTGDNTPRPPITPGQSTPGSPSPWGSR
PASLYPAGDWRNSQQEEINEINRWSDFGLAGGHDEGVILKKGRGAYTCCPADIVEEPYGF
FKAVETLNVRTAMTVNTRVIKLFLHNNDRPFVPLKGGLRLQVLPDMSYLPRCQKHQFAAF
IADRGILVVWDDEPRHLLDRAAKIEQQLMEMIWDDETTGDDEKKEEGAVEVNEISQEEAD
LEAGAVDTKRGICMWMPIISAFTLCLTVTALGSGCKTLQRKSGSMGTTSALVGNIAQLIG
PISQMQQNSKFYSGQAPKRLHRDVAVLPHVTIQMPVYKEGLQSVIEPTIRMRALARTSMT
SHNIGWVARPKHNPKPKDGSEVFLRRGKFKKASNMNYAMWVSVRVEEKLKDIQRHEQWTQ
EDEAQAYREALNQAVEEDQGRTWADGNIRIGDYILIIDSDTRVPTDCFLDAVSEMEQCPQ
VAIIQYPSGVMNITDSFFERGITFFTNLVYTQIRYAVANGDVAPFVGHNAIMRWAAMQEI
AYDAIDGDEREKYWSEET

Enzyme Prediction     

No EC number prediction in OTA23999.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	453	544	9.1e-26	0.4467005076142132

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	6.31e-24	453	542	1	89	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133034	Glucan_BSP_MdoH	1.27e-06	452	539	97	185	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.
133045	CESA_like	2.42e-06	430	540	69	169	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
235476	PRK05454	6.64e-06	284	536	88	307	glucans biosynthesis glucosyltransferase MdoH.
133043	CESA_CelA_like	1.21e-05	328	540	1	175	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
USW53192.1|GT0	3.19e-249	1	558	1	610
UJO15800.1|GT0	3.95e-237	1	558	1	610
SMY19115.1|GT0	9.69e-221	1	558	1	605
SMQ45410.1|GT0	1.94e-220	1	558	1	605
SMR43958.1|GT0	5.51e-216	1	558	1	622

PDB Hits     

OTA23999.1 has no PDB hit.

Swiss-Prot Hits     

OTA23999.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000001	0.000051

TMHMM  Annotations     

There is no transmembrane helices in OTA23999.1.