CAZyme Information: OTA23324.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA23324.1
• CAZy Family: AA7
• CAZyme Description: Cellulase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1Z5SR70]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350		39894.71	5.5718

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000303:2293-3345(-)

Full Sequence      

MGLDVRHRRDIARTIRKMGFNSVRFPYSDQMVIENPRVDVKHISANLDLLDNYSLAQGNQ
SRIDDEARGPRALDIYAACIEAMTEAGLAVIPNNHITNAAWCDGKNLCDSSWKNDQYGPI
CKVHQTTDTWIEHWLTVMQPHVNNPLVIGADLRNEPRGIWGTMTWNMWATAAEKASEALL
KLQPNWLMFVEGVSSANDCSGAGRRPVQLSVPDRVVYSSHVYSWSGWGSLVPYHKREYDS
FAKDMDRNWGYLLSSDTAPVWVGEFGASHNSDEGAHHYWDNLMKYLQLADADFGYWALNP
RKPEKYDNETYGLLKPDWETPVDDFRLADLRRLMNQDSVKDVRAASNILE

Enzyme Prediction     

No EC number prediction in OTA23324.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	2	303	5.5e-139	0.9015873015873016

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	3.31e-18	10	300	28	270	Cellulase (glycosyl hydrolase family 5).
225344	BglC	8.75e-15	8	341	75	398	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO13321.1|GH5_24	5.19e-187	2	343	91	432
QIX01602.1|GH5_24	8.41e-173	2	334	67	396
SMR47855.1|GH5_24	8.05e-168	18	334	1	317
SMY21762.1|GH5_24	8.05e-168	18	334	1	317
SMQ48069.1|GH5_24	8.05e-168	18	334	1	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ECE_A	2.48e-36	2	320	40	338	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
1VRX_A	4.81e-36	2	320	40	338	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]
4TUF_A	3.14e-21	2	333	36	343	Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_B Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_C Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_D Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913]
3VVG_A	1.33e-19	2	335	47	377	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3W6M_A	1.33e-19	2	335	47	377	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	3.57e-38	2	320	73	369	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P54583|GUN1_ACIC1	2.24e-34	2	320	81	379	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|C0HLA0|GH5FP_CHAOB	5.23e-24	11	318	74	379	Glycosyl hydrolase 5 family protein OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1
sp|P19487|GUNA_XANCP	4.72e-20	2	333	61	368	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2
sp|P50400|GUND_CELFI	3.42e-18	11	320	89	400	Endoglucanase D OS=Cellulomonas fimi OX=1708 GN=cenD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OTA23324.1.