CAZyme Information: OTA22700.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA22700.1
• CAZy Family: PL26
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505		57368.10	6.4510

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000349:13193-14710(+)

Full Sequence      

MTFTWRSKPVRAFILCLLAFIALSSLYTALGLGGPEYQRIASHAIQDATEAAQYTRANLL
NRLPGSTTKTRSAHCSGIPDDGTIAITVKTGATEALSKLPAQLETSLRCIKDPILVSDLA
QTLGRHQIHDVLATASSSESMAKNPEFDIYRHQQRLAEIGGLDDLALAHLKRMPMPEQDW
RTAGKTAAWGLDKYKFLHMVEKAWELQPGRQWYVFIEDDTYLSLRGLRTFLQQYDWKEKW
YLGSPVKMWEHKPQPLWFGYGGSGVILSGAVVEEWCTRHPGLASAWDPKVRRKWFGDFVL
ADALNDELAVQLTDAWPMLHNDEPALATFSPETWCKPVVTMHHLDAREMDELYQAEQALG
SRTLRFKDVYKAFYKPGLPFKKSDWDNLAGERAELELEFPTNDLSKTHGKFSTASMEDLN
QFFEGCEVACTQNPACFQFTHLITTKNSTEREGECHLTGVFRLGKKRMEESGIEKETGTE
WKRTWVSGWRSDRIGRFVDDEDRCG

Enzyme Prediction     

No EC number prediction in OTA22700.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	6.10e-10	197	333	72	215	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
215605	PLN03153	0.004	208	364	209	360	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMQ49609.1|GT31	4.01e-114	37	504	30	487
SMR51543.1|GT31	4.01e-114	37	504	30	487
SMR50600.1|GT31	4.01e-114	37	504	30	487
SMY23300.1|GT31	4.01e-114	37	504	30	487
QIW95637.1|GT31	1.26e-111	75	498	51	459

PDB Hits     

OTA22700.1 has no PDB hit.

Swiss-Prot Hits     

OTA22700.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.896528	0.103505

TMHMM  Annotations     

Start	End
12	34