CAZyme Information: OTA22666.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA22666.1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	MUNK01000352|CGC1	40076.35	6.6031

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000352:11983-13083(+)

Full Sequence      

MNPPPIPARPGAPSSRRVVLYHQTHHGPNNGPAVSLLPLITQDTGVTHVIVAAIHLNEGP
KNITLNDHHPDHERFATLWGEVTWLQASGVKVLGMLGGAAQGSFARLDGEDTARFEAYYA
PLRDMLRKHRLDGVDLDIEEPTTIPGIVRLIDRLRADFGSAFLITLAPVATGLLVNTPHL
SGPAFNYHVLEAMRGHEIAWYNAQFYNGWGDCSNPFWYETIVRIGWKPEKIVIGLLTNPA
NGGSGYVQQQHVEAVLHSLRQKHPDLGGVMGWEYFNALPGEQAKPWEWAARMSRCLNAPL
QSAPTAAQQTPVRPFGQEALSAPPHPYPAESVRTLQDLGFSQQQAIAALNSTSGNVEYAA
GLLFQD

Enzyme Prediction     

EC	3.2.1.96:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	34	246	2.5e-19	0.6148648648648649

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119363	GH18_CTS3_chitinase	1.62e-136	17	277	1	256	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.
119349	GH18_chitinase-like	8.72e-20	18	276	2	209	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119350	GH18_chitinase_D-like	1.17e-15	81	272	65	293	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
395573	Glyco_hydro_18	2.59e-12	44	235	21	220	Glycosyl hydrolases family 18.
270494	UBA_scDdi1_like	9.01e-12	330	364	2	36	UBA domain found in Saccharomyces cerevisiae DNA-damage response protein Ddi1 and similar proteins. Ddi1, also called v-SNARE-master 1 (Vsm1), is a ubiquitin receptor involved in regulation of the cell cycle and late secretory pathway in Saccharomyces cerevisiae. It functions as a ubiquitin association domain (UBA)- ubiquitin-like-domain (UBL) shuttle protein that is required for the proteasome to enable ubiquitin-dependent degradation of its ligands. For instance, Ddi1 plays an essential role in the final stages of proteasomal degradation of Ho endonuclease and of its cognate FBP, Ufo1. Moreover, Ddi1 and its associated protein Rad23p play a cooperative role as negative regulators in yeast PHO pathway. Ddi1 contains an N-terminal UBL domain and a C-terminal UBA domain. It also harbors a central retroviral aspartyl-protease-like domain (RVP) which may be important in cell-cycle control. At this point, Ddi1 may function proteolytically during regulated protein turnover in the cell. This family also includes mammalian regulatory solute carrier protein family 1 member 1 (RSC1A1), also called transporter regulator RS1 (RS1) which mediates transcriptional and post-transcriptional regulation of Na(+)-D-glucose cotransporter SGLT1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO12460.1|GH18	7.73e-186	1	366	1	358
SMY23583.1|GH18	3.54e-183	14	366	38	392
SMR51826.1|GH18	3.54e-183	14	366	38	392
SMQ49901.1|GH18	5.02e-183	14	366	38	392
SMR50887.1|GH18	7.13e-183	14	366	38	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y8V_A	4.34e-117	5	297	2	289	Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_B Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_C Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_D Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293]
4AC1_X	1.48e-79	17	289	4	272	Chain X, ENDO-N-ACETYL-BETA-D-GLUCOSAMINIDASE [Trichoderma reesei]
2MR9_A	4.09e-06	327	365	5	43	NMR structure of UBA domain of DNA-damage-inducible 1 protein (Ddi1) [Saccharomyces cerevisiae S288C],2MRO_B Structure of the complex of ubiquitin and the UBA domain from DNA-damage-inducible 1 protein (Ddi1) [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

OTA22666.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000001

TMHMM  Annotations     

There is no transmembrane helices in OTA22666.1.