CAZyme Information: OTA22089.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA22089.1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
987	MUNK01000404|CGC1	110902.95	5.5345

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000404:8394-13480(-)

Full Sequence      

MYEMELKPGSKRNMLAMTGVITSTTIKNSIITVLQDMEYIHGQLFERTVESGCGAVTCLP
GALTMLRFSAFRRMAKWYFADKAEQISDLFDWGKCHLGEDRWLTHLFMIGARERYQIQMN
TGAFCKTEAVQTFKSLLKQRRRWFLGFITNEVCMLTDVRLWRRYPVLLVIRLAQNTIRTT
ALLFFIMVISIVTTSQKISNLPVGFIAVSLGLNWLLMLYFGAKLGRWKIMLYPLMFVLNP
FFNYIYMVYGIFTAGNRTWGGPRADAAIKADEHTTPAEAIEKAEEEGNELLLVPETLKPA
SAALVLPSDVASDKHKTQGLRNKLLASLSVDGIAAYKLTPNVELLCLADAIVTHPAVLKG
VEPARWAKLRTGVCRQRLLSEPSSTLQNLIYDDLDVVEEQLGKLEGSFKEQAQVEFLLER
AEVDTHHGLDKIARQNLDEAKQRRRFEYALTGLLGKRTKFQEKDFSQLVVLAKSASNDES
GSTETSDAAPGPVEKEETGPAKLDLNDDTLLEPKESESASASERLRYIFQLASPYGWDLE
AELAARWVQLGGLRSALEIYERLEMWAEAALCWAATEREDKAKNMIKKQLFHATSGKSDV
EADDDETWEGEERQPPPMDAPRLYCILGDIDQDVSMYEKAWTVSKERYARAQRSLGRLYI
TKGDMVKAAEAYSKSLRVNQLNQQSWFALGCALLELAQFEKAVAAFGRCVQIDDMDAEGW
SNLAAALLRCEPDTDDGAKPGAAPADDEDESVITYREKPDPQKHRQDALKALKRAAGLKH
DSYRIWENLLIVAASLSPPDYNSALAAQKRIIDIRGKTDGEKCIDKQILEMLASHVITTS
DRYDATQPGLPRIFVKFMDESVIPLITGSAELWQLVSKLALWRNKPSSALDAEEKSWRAV
TAQPGWETENEKLWNLVVDATVRLCEAYESFGPMERTEGLASGEPVAKDWKFKARSALRG
ILGKAKGTWEGTDGWERLQETMQGLKA

Enzyme Prediction     

EC	2.4.1.16:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	14	269	6.1e-24	0.5066413662239089

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133033	Chitin_synth_C	1.31e-17	2	143	96	237	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
367353	Chitin_synth_2	3.81e-16	19	263	234	493	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
276809	TPR	2.65e-13	649	729	1	81	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
224136	BcsA	2.18e-11	31	252	186	397	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
276809	TPR	2.20e-10	623	711	10	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX99330.1|GT2	2.52e-167	1	303	265	566
CAE7027846.1|GT2	7.10e-166	1	303	291	592
QRD05648.1|GT2	3.91e-164	1	303	292	593
QDS70805.1|GT2	4.17e-164	1	301	288	587
SMR59275.1|GT2	4.16e-161	2	307	287	591

PDB Hits     

OTA22089.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78746|CHSD_ASPFU	4.00e-150	1	290	234	522	Chitin synthase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsD PE=3 SV=1
sp|O36033|YLM1_SCHPO	1.02e-80	320	986	92	817	TPR repeat-containing protein C19B12.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC19B12.01 PE=4 SV=2
sp|P42842|EMW1_YEAST	8.52e-57	502	980	476	899	Essential for maintenance of the cell wall protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EMW1 PE=1 SV=1
sp|Q8CD92|TTC27_MOUSE	7.93e-34	306	699	126	581	Tetratricopeptide repeat protein 27 OS=Mus musculus OX=10090 GN=Ttc27 PE=1 SV=2
sp|Q17QZ7|TTC27_BOVIN	4.23e-33	306	699	126	581	Tetratricopeptide repeat protein 27 OS=Bos taurus OX=9913 GN=TTC27 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000001

TMHMM  Annotations     

Start	End
12	34
49	71
168	190
200	222
229	251