CAZyme Information: OTA22077.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA22077.1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
857		96041.40	6.9474

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000405:20537-23633(+)

Full Sequence      

MDPADIERGYSPPFEHSPSVENIVIPAHLLATVSDQEIWTPDHDRQRDSSPHRTDARRTF
DIQGMVAEQQHEVEQLDNIAIDFIQQPTTGEHWQRRAGSLGTNYASRPRATTLQGVSNDP
GYQGRKTSLPTILRTFPRADACESDPQTQQEPDHSNRAPSLDKGSDVGFQRFGSRLEDIA
ETPEGGLTVPVDQIPEGTVLFKRLSSYNLLFANGTEPKSASRKSLDDQDSMDPHTPTYFV
AEDQNYEKDTGDGLARLPTMNPAFSDNTAGQRARRSTLQTVANTVVTAVQSTTAAVTASA
RRTTLADIYEKAKVRKTELERKKWVQIAFEVTFYLILLCFIYFVLIGVPLWRGAVWWLFW
VVSNKFVVAGTWSITIGLAVFYAYAPLLILFEKEPPMPEPSEGFDATKTPGVQNTALLIP
CYKSARIIGPTLEAALKIFPANHIYVIANGNSPTPLDNTEEVCRPYGVNHIWSPVGSKIV
AQFVGCYAAKHFENVLLIDDDCALPPNFPIVSDRMKGMVKCIGYTIKSVGPNSSKGTLCQ
QAQDLEYKISGLQRAFAGNIGSATFPHGAISLWNTRFLIETFHTHPGFSVSEDWFFGHVA
RQLGCRIRMCTAIFVETETPTDVFVSGGGSRGGFGEMTIFKQRFYRWNFFFVNGMYYNMA
YILGSWKLGWWEIGAKLFVWQEVYETLLYLLAPFVLPISFIVRPDFCGYLMAGTFVLYYI
NVIIFNEIHLRLRNERVGFVAVYLYYAPYKIVLTAINILSCYYSLYKYARYFAKRHPKVI
EDERAVEVVLRLEEQPPSPTRPSIGESQGRRMTVTAVGMRLGSAAPRPSLAGTPTAEPTR
PSFSVLPTEEPYKSQAA

Enzyme Prediction     

No EC number prediction in OTA22077.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	415	623	7.4e-25	0.9260869565217391

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404520	Glyco_tranf_2_3	6.33e-29	413	647	2	227	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
404513	Glyco_trans_2_3	2.61e-10	495	716	2	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133045	CESA_like	5.08e-08	417	593	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
132997	Glyco_tranf_GTA_type	1.92e-06	418	508	2	94	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
133022	DPM_DPG-synthase_like	0.002	417	470	1	53	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7014388.1|GT2	1.49e-251	254	820	203	756
QKX60961.1|GT2	2.93e-248	301	825	165	691
UPL00273.1|GT2	4.07e-246	299	814	167	678
CAK44102.1|GT2	2.44e-243	302	825	166	692
BCR93365.1|GT2	7.42e-243	302	832	166	702

PDB Hits     

OTA22077.1 has no PDB hit.

Swiss-Prot Hits     

OTA22077.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

Start	End
331	353
368	390
647	664
679	701
706	728
743	765