CAZyme Information: OTA21051.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA21051.1
• CAZy Family: AA2
• CAZyme Description: putative mannosyl-oligosaccharide alpha-1,2-mannosidase 1B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540		59622.57	4.2464

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000427:4624-6737(+)

Full Sequence      

MKLYSLVFLPLAFGLPTQDSYDPQGKGSGKGHGKGHGRGNGNDTWPGKHPEYPVDYTNDP
KERAAAVKEAFQYAWDGYYKYAFPNDELRPLDNGFSNSRNGWGASAADALSTALVMKCPE
IVNQIIAYVPTIDWSVSYQDEAVSLFETTIRYLGGLLSGYDLLSGPLSHLAENPDYVPDL
LNQAANLANNLSYAFETPTGIPHNNLIFSDRSDDGSTTNGLATIGTLVLEWTRLSDLTGN
ETYAQLTQKGESYLLNPQPAYNVPWPGLLGTNVDISTGLFTDASGGWNGGDDSYYEYLIK
MYVYDSARFGVYRDHWITAADSTIEHLASHPSSRPDLTFLAQYDNRTLDKTSGHLACFDG
GNFILGGLVLDEQKYIDFGLQLVEGCEDTYNQASTLTGIGPESFAWDDSSVPAAQAEFYE
RAGFYITNSQYILRPEVLESFYYAYRATGDSKYQEYSWNGFKAINATCRTGSGFAEITDV
NAENGGSFQNFQDSFLFAEVLKYSYLIHTDEAPWQVNSGGVNEYVYNTEAHPFKVVGTPV

Enzyme Prediction     

EC	3.2.1.113:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	70	535	5.3e-125	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	70	535	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	5.01e-110	61	539	70	522	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO19644.1|GH47	7.13e-263	61	540	47	525
ATZ45864.1|GH47	5.62e-254	62	540	46	530
CCD45524.1|GH47	5.62e-254	62	540	46	530
EDO01992.1|GH47	1.24e-249	62	540	42	526
APA06883.1|GH47	1.24e-249	62	540	42	526

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	1.64e-221	63	535	5	473	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	4.21e-221	58	535	32	508	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
1HCU_A	4.80e-181	63	535	15	492	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
5KKB_A	8.17e-57	61	536	20	468	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	9.96e-57	61	536	18	466	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CP08|MNS1B_ASPCL	2.83e-223	51	535	23	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mns1B PE=3 SV=1
sp|A2QAS2|MNS1B_ASPNC	4.05e-221	53	538	30	513	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|Q12563|MNS1B_ASPPH	5.75e-221	61	538	40	513	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1
sp|P31723|MAN12_PENCI	2.17e-220	58	535	32	508	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2
sp|Q0D076|MNS1B_ASPTN	6.96e-216	52	535	22	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000285	0.999681	CS pos: 14-15. Pr: 0.9711

TMHMM  Annotations     

There is no transmembrane helices in OTA21051.1.