CAZyme Information: OTA20775.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA20775.1
• CAZy Family: AA12
• CAZyme Description: Fn3_like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1Z5SMA8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
867	MUNK01000433|CGC1	94188.11	4.7527

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000433:15618-18842(-)

Full Sequence      

MYAPARFPNITYPDAVSPNPNVLLGTQSNQESPLKYPSPWSTGQGDWAESYKKAIALVKQ
MTLDEKVNLTTGTGWRTEFCVGNTGEIPRLGIRSLCFQDSPTAVRYTDFVSVFPQGVNVA
ATFDRKLAYMRGKLLGEEHRDKGVNVALGPVAGPLGRSPEGGRNWEGFSPDPYLTGVLFA
DTIKGMQSAGVLASAKHFIGNEQEHFRQIVESIDYGFNISQPGSSNIDDQTLHELYLWPF
ADGVRAGAASIMCSYNLLNNSQACQNSYMQNYILKGELGFQGHILSDWQATASGVSAILA
GLDVSMPGDTSFNTGYSYFGPNLTIAVLNGTVPQWRLDDMAVRTLASWFYVDGDTAGVDL
NFQSWTSDVYGPLHAYAGPEYGYGLVNQHVDVREEHGEFIRRLGAASTVLLKNERNTLPL
SGHERLTAVFGEDAGDNPAGPNGCRNRGCDIGTLAEAWGSGQGEFPYLVTPRTALQNEVV
SHYGAFEAITNNSAFAEIAALGKLATEVHGVCIAFVNADSGEGFINVDGNIGDRKNLTLW
QGAPGMLANLTANCNNTVLVVHGVGPVELEVYKQNPNVTAILWAGLPGEQSGNSIADVLY
GRTNPGAKLPFTIGKERSDYGTDVLYTPNQLIPQFNFREGVFIDYRTFDYRNITPTYEFG
HGLSYTTFEYSNLEVQSIEAGDYAPNTKGWSPAPTFGSINNSSSAYLFPSNMTRVPLYIY
PWLNSTNLSRAYGADGYGDSSFVPEGALDGSSIEAHPAGGAPGGNPLLWDVLYRVTADIT
NSGPVGGIEVPQLYLSLGGPYDPKIVLRGFERLSIQPGETVQATFDLKRRDLSNWDTVSQ
NWRITDYTKTLYVGSSSRKLPLSAVLR

Enzyme Prediction     

EC	3.2.1.21:43	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	86	307	8.7e-59	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396478	Glyco_hydro_3_C	7.54e-51	408	645	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	8.82e-46	86	440	54	370	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	5.64e-39	57	836	41	734	beta-glucosidase BglX.
178629	PLN03080	1.01e-33	53	671	52	639	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	8.28e-32	112	345	87	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQA29329.1|GH3	0.0	5	866	24	888
UJO17757.1|GH3	0.0	5	866	24	888
USW53260.1|GH3	0.0	8	866	35	890
ABX79553.1|GH3	0.0	32	866	26	858
AFU51372.1|GH3	0.0	32	866	26	858

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FJI_A	0.0	32	866	6	840	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]
5NBS_A	0.0	13	866	2	856	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]
5JU6_A	0.0	32	867	25	852	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
5FJJ_A	0.0	32	866	7	838	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
4IIB_A	0.0	32	866	6	837	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UUD6|BGLA_ASPOR	0.0	32	866	26	857	Probable beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglA PE=1 SV=1
sp|A1D451|BGLA_NEOFI	0.0	28	866	28	869	Probable beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglA PE=3 SV=1
sp|Q0CTD7|BGLA_ASPTN	0.0	32	866	26	857	Probable beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglA PE=3 SV=1
sp|A1CR85|BGLA_ASPCL	0.0	32	866	31	863	Probable beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglA PE=3 SV=1
sp|P87076|BGLA_ASPKW	0.0	32	866	25	856	Beta-glucosidase A OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=bglA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OTA20775.1.