CAZyme Information: OTA19808.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA19808.1
• CAZy Family: AA11
• CAZyme Description: Beta-mannosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
728		83813.77	6.0837

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000455:955-3197(+)

Full Sequence      

MFVMHRVDVSRHLAKRGSHFLEIEFRPASLEARKIREAHPEHRWVGFNGDVSRLAVRKAQ
YHWGWDWGPELMTCGPWREVRLESYCARIKHLRVDYHVAHDLQSVRGTIQADIEGPGKQV
EFTAALDGVEVLNETTDVDDDGKAAVEFIVKQPKLWYPHGYGPQPLYTVSASLMDGSDML
HGLSKRTGFRKLDLVQDPDEVGKSFYFRVNGVDVFCGGSDWIPADSFTPRTTAAKYRTWL
QMMVDGYQIMIRIWGGGIWEEDVFYELCDELGILVWQDFMFACGNYPAYPAMLKSIEQES
VCQTRRLRHHPCLAIFAGNNEDYQVQESSGLTYDYKDKDPQSWLKTDFPARYIYEKLLPD
VVAAHCPHVPYHPGSPWGDGKITSDQTVGDMHQWNVWHGTQEKYQIFDQLGGRFNSEFGM
EAFPHIDTIKYFLTDPSQLYPQSHMIDFHNKADGHERRIATYLVENFRTRTELDKFIHLT
QLSQAEALMFAYRGWRRQWGQQRLCGGALVWQLNDCWPVTSWAIVDYFQRKKPAYYVMRR
ALAPVAIAVRREHHDWSVVHARPAKQSKYECWVASSKLEEITASVELRYISIATGHDIKD
KVFLEDVRIVPNGTTELFQGVIDNEREEPHVLSARVWVDQALVSRDCDWPQPLKYLDFTD
RGVSVESDNGTITVRARKPTKGLVFEEREGVLVTDSALDVVPGDEQTIEVRGMGMDSKDL
DWTFLGAP

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	1	621	5.4e-69	0.5757978723404256

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	2.78e-59	1	548	108	635	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	1.23e-12	567	655	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	5.74e-10	87	190	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO13387.1|GH2	0.0	1	728	117	845
SMR45932.1|GH2	0.0	1	728	108	836
SMR47185.1|GH2	0.0	1	728	108	836
SMQ47400.1|GH2	0.0	1	728	104	832
SMY21082.1|GH2	0.0	1	728	108	836

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.22e-113	1	549	126	660	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
6BYE_A	1.97e-97	1	728	115	858	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	2.01e-97	1	728	115	858	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	1.38e-96	1	728	113	856	Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	1.41e-96	1	728	115	858	Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CGA8|MANBB_ASPCL	0.0	1	726	109	844	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
sp|Q2TXB7|MANBB_ASPOR	0.0	1	726	109	843	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
sp|Q5B7W2|MANBB_EMENI	0.0	1	726	109	842	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
sp|Q4WAH4|MANBB_ASPFU	0.0	1	726	109	844	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
sp|A1D911|MANBB_NEOFI	0.0	1	726	109	844	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OTA19808.1.