CAZyme Information: ORE10582.1

Basic Information

• Species: Rhizopus microsporus
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus microsporus
• CAZyme ID: ORE10582.1
• CAZy Family: GT49
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
683		78393.53	6.5999

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmicrosporusATCC52814	11554	N/A	58	11496

• Gene Location: location=KV921864:110710-113078(-)

Full Sequence      

MTHLNIETLAQDLNIPIHHSGRWFKDDQGRTLILRGVNVCGSSKLPTRPYPGSTHLYDEN
LFWDHRNVSFIDRPFPLKDAHEHFSRLRNWGLTLIRLLVPWESIEHAGPGSYDEEYIDYL
RELIKMMPKYGLKCIIDPHQDTWSRFSGGSGAPGWTFEVAGLNIKNFKETGAAYVHNTNA
VPGDPLPMVWPTNYTKLASCTMFTLFFAGDTFAPKRTFQGQTIQQFLNDHFIRAYEHLAQ
RLVDLDAVLGFEFMNEPHPGYIGLDHLDSFDPIVNLFFGDSPSPLQCFALGAGIPQSVGV
YVKSWPFPTKKSHDRVINASKASAWVDHCIWKEHGVWKVDDHGNPQLVNTHYFSKHPVTG
EKVSFYNDFYKPLVNRYVKAIQAVKKEYYCLVEPLANERPPVYDEDDYHHRVIFSPHWYD
LNCVFYKKFNGKITHDVQHLQRGGNVLKATYFGKSGAKKNYRGQIRNIKEDGIKNMGEKP
CILGEVGIPMDLNNRVAFADDDYSSHIDFMDSVLYALETNLMSFILWNYDVCNDHEYGDH
WNGENFSIYSAKKAKEDYLEHDDEKSALSKRHLYDGGRVLEAVLRPYAVKVAGTPVSAEF
NLDTLQYTFSFIPHGNTEHSKVTEIFVPYLHYGNKTINTKVNVGECYYDEEKQTLYHYYK
GDEAPKQVTIELGVITPQSCTVM

Enzyme Prediction     

EC	3.2.1.45:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	26	535	1.7e-193	0.9981447124304267

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408348	Glyco_hydro_5_C	1.40e-19	585	671	1	85	Glycoside hydrolase family 5 C-terminal domain. This is the C-terminal domain of endo-glycoceramidase II (EGC), a membrane-associated family 5 glycosidase pfam00150. The C-terminal domain assumes a beta-sandwich fold, which resembles that of many carbohydrate-binding modules.
395098	Cellulase	5.71e-04	84	142	30	89	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EIE79467.1|GH5_12|3.2.1.45	0.0	1	683	1	683
CDS13578.1|GH5_12	0.0	7	683	15	724
UQC90076.1|GH5_12	2.37e-177	10	672	7	740
ULM60693.1|GH5_12	7.72e-176	16	672	71	815
UPL04364.1|GH5_12	2.89e-171	16	672	18	739

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LPO_A	1.39e-102	17	632	21	716	Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99]
2OSW_A	2.67e-16	23	260	36	228	Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OSW_B Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OYK_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYK_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYL_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYL_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYM_A Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.],2OYM_B Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.]
2OSX_A	2.67e-16	23	260	36	228	Chain A, Endoglycoceramidase II [Rhodococcus sp.]
2OSY_A	1.46e-15	23	260	36	228	Chain A, Endoglycoceramidase II [Rhodococcus sp.],2OSY_B Chain B, Endoglycoceramidase II [Rhodococcus sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1BTD7|EGCR1_RHIO9	0.0	1	683	1	683	Glucosylceramidase OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) OX=246409 GN=ERC1 PE=1 SV=1
sp|H1AE12|EGCR1_CRYNH	7.40e-148	21	670	20	688	Glucosylceramidase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=EGC1 PE=1 SV=1
sp|H1AE13|EGCR1_ASPFM	5.79e-118	21	645	10	699	Glucosylceramidase OS=Neosartorya fumigata OX=746128 GN=egc1 PE=1 SV=1
sp|P40566|EGH1_YEAST	2.59e-112	24	660	13	730	Ergosteryl-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EGH1 PE=1 SV=1
sp|Q9GV16|EGCSE_CYANO	2.25e-08	13	265	30	248	Endoglycoceramidase OS=Cyanea nozakii OX=135523 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000018	0.000019

TMHMM  Annotations     

There is no transmembrane helices in ORE10582.1.