CAZyme Information: ORE10382.1

Basic Information

• Species: Rhizopus microsporus
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus microsporus
• CAZyme ID: ORE10382.1
• CAZy Family: GT4
• CAZyme Description: Chitin synthase [Source:UniProtKB/TrEMBL;Acc:A0A1X0REG5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1874	KV921866|CGC1	211671.82	6.8589

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmicrosporusATCC52814	11554	N/A	58	11496

• Gene Location: location=KV921866:130298-136046(+)

Full Sequence      

MKKSRKSNLKEDDSNRIDVSTLSNTSSESITSCLRSRYNELKIYTNVGSRHIIALNPLKE
LPMNDDQASLEYVAAYKDATGHKQTPDPHLFDLINRTYFHMRRTGSDQAIMLKGVAGSGK
SEIRRLTIRHLVRLSSHKKESKVQTQIIESQKVLEAFGHCQTNTSSSASRFSYYGEIQFN
ERGRMVGSKTLHYSLESSRVTNSSITTASDGNFNIFYYLLAGVSPDERSTLQLTDPSSYP
YLQKFKRPVLPTDSQRFEDLKVAMKHLGFKKEQIGRVIQLVATILHLGNLSFVDPTGTGT
QEAAFVKNAELLDLVADFLGLDPHALENVLTFKTTMIRKDITTLILNAQQAAEQRDELCQ
VLYSLLFSWIVEKINSKTCTEEFNSFIGILDFPGLQSYYPVAGFEQLCVNLVNERIQQYM
DQTLFQVETDVFRAEGIHVPDINYQSTALDLLTRPKGICHEVNTMTDVSKRAYTDNNIMD
SIIKFNSTHPAFSVKNSDTNARHFVVQHFGNTPVEYSTEGFIAQNNNQISVDFLSLFKGG
MDVQPSWNSFVVELFANVKTQSHPKHTTAIISAQQSAKPMRAPSQRKSTRRTNGNNGSNE
KGGSDGTGPTTVLAQIQSALDELIESLGEAKLWIVYCILPKLKESGNFDTKLVQSQIDMF
KIPSLLQLPTIQYVESYEHHEFLEHYGHLFEGLDTTRLLRSQCEMAAGIMGWTAPNMSIT
QNKVFLSAIAWRELEDKLRSYEKVEQRQAKDSNKEGDTGSVSHPFAAAAAAAGLPLPPQN
YYDNDHGSFYSEDESGQYMEQEGSFYGSESYGSHQGGLALIPQQAPVIENINETEEDETK
MSAGRKRWLFFVYFCTWWIPSKFLVWCGRMKRKDIRVAWREKVTLCMIIFLMCAFVIWFL
VFFSEVICPKQHIYSLAELASHDKTNSKGAYVAIRGEVFDLTKFAPHHYPMNLVPTSSVM
EYGGQDVTNLFPVQVSALCPGVSEFVSLDYQINLTDTNGQYHDFRYSSDVYNPNWYYDQM
TMLRKNYKVGNMGYEYKAISDQASAATTINGIKALRIWAVINDRIYDLTSYTMGGRYARG
PPGTTPPADINPNFLSQQVVDLFQQHSGQDITNAFYNLNLDQASLQRELVCLRNLFFVGY
VDSRNSTKCQFSEYLLLVVTCLLAAVIVFKFVAAIRFGGKRAPEEHDKFVICQVTCYTED
EESLRKTIDSIARLHYDDKRKLLFVICDGMIVGSGNDRPTPRIVLDILGVDPQVDPEPLS
FVSVGEGSKQHNMGKIYSGLYEVAGHVVPYIVVVKCGNPRERQKPGNRGKRDSQLVLMQF
LNRVHYDAPMNPLQLEIYHQMKNVIGVSPEFYEFVLMVDADTEVMPDGLNYLVSSAVHDS
KIIGICGETTLANEKDTWVTMIQVYEYFVSHHLIKSFESLFATVSCLPGCFTMYRIRTVD
GKRALFISNEIIADYSVNVVDTLHKKNLLHLGEDRYLTTLLLKHFANFKTKFNSDAQCKT
NAPDTWSVLVSQRRRWINSTIHNLGELVFLPRLCGFCCFSMRFVVLLDLISTAVMPALLG
YLGYLIYTLATWEGSVPIISIATIAGTYGLQALLFIIKGRWEFIMWMIVSLFAMPVFSFY
IPIYSYWHFDDFSWGNTRIVVGEKGKKVAVTADEGTFDPKSIPTMKWSEYEQQILSEDRW
SDNVSQSSGYTHGSRGNYPRPGPGSVYGAASGMMMMPDNMSVHSSSRSVAQQQQQARQTM
GFDHNSMIFPSSASTPMMPYTNNSTSMLPSSRSMASFAPAQQFNTPGQYIPMQNSSQFNK
AGSSRSLMMDGFNTEGPKNEEIMQQVQRILETADLTKVTKKQVREELQNIFGVSMQSRKD
YINACIESVLQNRV

Enzyme Prediction     

EC	2.4.1.16:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	1166	1672	2.6e-232	0.9924098671726755

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
276845	MYSc_Myo17	0.0	26	736	2	647	class XVII myosin, motor domain. This fungal myosin which is also known as chitin synthase uses its motor domain to tether its vesicular cargo to peripheral actin. It works in opposition to dynein, contributing to the retention of Mcs1 vesicles at the site of cell growth and increasing vesicle fusion necessary for polarized growth. Class 17 myosins consist of a N-terminal myosin motor domain with Cyt-b5, chitin synthase 2, and a DEK_C domains at it C-terminus. The chitin synthase region contains several transmembrane domains by which myosin 17 is thought to bind secretory vesicles. The catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.
367353	Chitin_synth_2	0.0	1167	1673	4	527	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
214580	MYSc	2.27e-125	18	739	10	677	Myosin. Large ATPases. ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin.
276950	MYSc	2.31e-123	28	727	1	633	Myosin motor domain superfamily. Myosin motor domain. The catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.
276849	MYSc_Myo22	2.54e-105	28	726	1	660	class XXII myosin, motor domain. These myosins possess an extended neck with multiple IQ motifs such as found in class V, VIII, XI, and XIII myosins. These myosins are defined by two tandem MyTH4 and FERM domains. The apicomplexan, but not diatom myosins contain 4-6 WD40 repeats near the end of the C-terminal tail which suggests a possible function of these myosins in signal transduction and transcriptional regulation. The catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS06114.1|GT2	0.0	10	1874	5	1895
CDS06732.1|GT2	0.0	6	1874	3	1887
CDS08031.1|GT2	0.0	18	1675	13	1690
AZQ26801.1|GT2	0.0	18	1873	17	1909
QDK64613.1|GT2	0.0	18	1873	17	1909

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5I0H_A	4.98e-67	18	735	67	735	Crystal structure of myosin X motor domain in pre-powerstroke state [Homo sapiens],5I0H_B Crystal structure of myosin X motor domain in pre-powerstroke state [Homo sapiens]
5I0I_A	1.16e-66	18	735	65	733	Crystal structure of myosin X motor domain with 2IQ motifs in pre-powerstroke state [Homo sapiens],5I0I_B Crystal structure of myosin X motor domain with 2IQ motifs in pre-powerstroke state [Homo sapiens]
1FMV_A	3.11e-66	18	657	90	676	CRYSTAL STRUCTURE OF THE APO MOTOR DOMAIN OF DICTYOSTELLIUM MYOSIN II [Dictyostelium discoideum],1FMW_A Crystal Structure Of The Mgatp Complex For The Motor Domain Of Dictyostelium Myosin Ii [Dictyostelium discoideum]
3MYH_X	3.16e-66	18	657	90	676	Insights into the Importance of Hydrogen Bonding in the Gamma-Phosphate Binding Pocket of Myosin: Structural and Functional Studies of Ser236 [Dictyostelium discoideum],3MYK_X Insights into the Importance of Hydrogen Bonding in the Gamma-Phosphate Binding Pocket of Myosin: Structural and Functional Studies of Ser236 [Dictyostelium discoideum],3MYL_X Insights into the Importance of Hydrogen Bonding in the Gamma-Phosphate Binding Pocket of Myosin: Structural and Functional Studies of Ser236 [Dictyostelium discoideum]
1MMN_A	3.16e-66	18	657	90	676	X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain [Dictyostelium discoideum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4P9K9|CHS8_USTMA	0.0	19	1870	10	2002	Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS8 PE=3 SV=1
sp|J9VNT4|CHS5_CRYNH	0.0	18	1870	15	1929	Chitin synthase 5 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS5 PE=2 SV=1
sp|O13395|CHS6_USTMA	3.69e-297	806	1709	32	932	Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS6 PE=3 SV=2
sp|J9VF17|CHS4_CRYNH	2.71e-277	755	1671	74	989	Chitin synthase 4 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS4 PE=2 SV=2
sp|Q4P333|CHS7_USTMA	1.07e-144	818	1679	48	959	Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS7 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000000

TMHMM  Annotations     

Start	End
848	870
883	902
1154	1173
1543	1565
1575	1597
1604	1626