CAZyme Information: ORE10080.1

Basic Information

• Species: Rhizopus microsporus
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus microsporus
• CAZyme ID: ORE10080.1
• CAZy Family: GT39
• CAZyme Description: alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Acc:A0A1X0RDG3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
832		95189.92	5.8975

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmicrosporusATCC52814	11554	N/A	58	11496

• Gene Location: location=KV921869:94714-97732(+)

Full Sequence      

MEAQYVLPFILSMVLSKYDKAGTFLLSLLILFSHICMAMTEERRLQLKDLSKEMFEHGWS
SYIEHAFPDDELNPFECRGRGSDKANPDNINVNDVLGDYSLTLVDTLDTLAIIGTRKQFE
EAVKQVIETVSFHQNNKVQVFELNIRALGGLLSAHMLITDPELDYSIEGYKDELLHLAVD
LANRLMPAFNSTKTGIPYPRVNLQKGVPPTETTETCTAGAGSLILEFGLLSRLTGDPAYE
EVAKRALKSVWNRRSHLSLMGNVIDIQTGNWIHTASSTGAGIDSVFEYMLKAYIIFGEDE
YLDMFEEAYRALMIYVRDSSGYIYRNVHMSTGSLMSYWIDSLSAFFPGLQVLYGDIHAAI
KNHLVFYNIWRRYHALPERFDFYQKRVNLPYYPLRPEFIESTYYLYQATKDPFYLDVGEM
VIQDLNNRTRLSCGFASIGDVESGKLEDRMESFMLSETLKYLYLLFDTEHPFNKRDSNAV
FTTEGHWISLPQHYLRRPKTAKQVKNLISIQSNPFGTCPRYNPLNYKAIYTPGHLDMTSI
PYQPQADYAAHIAGYTQSPLPPLSINGYCDSPWTLARNFNLSFGSIRRPNSVIEILGDYL
IKSLSGLKIEFVSAKRNDGFFIKGVHSSSIISNEQIYIDLDTLLPFLQDNRDLIQVQVRQ
PGLTRYRDYTQLDYDVILRTVNDYECMELIGLTSEFGAQTIQLPDTPIHIFGDQSKFLGC
EPYSRQDANMVKDKVLLISRGKCEFYKKALFAQEAGAVGVIFLSNEPHLFRPSFLKNDIR
IPCVLLPQTDSLVLLQQQTKRMYVTMDTLFLTPDSQFEMLLKRERVHNAILV

Enzyme Prediction     

No EC number prediction in ORE10080.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	54	488	1.1e-149	0.9932735426008968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	4.94e-148	54	486	1	449	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	5.27e-73	41	493	70	521	glycoside hydrolase family 47 protein; Provisional
240122	PA_subtilisin_1	4.50e-13	693	794	2	104	PA_subtilisin_1: Protease-associated domain containing subtilisin-like proteases, subgroup 1. A subgroup of PA domain-containing subtilisin-like proteases. The significance of the PA domain to many of the proteins in which it is inserted is undetermined. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Proteins into which the PA domain is inserted include the following subtilisin-like proteases: i) melon cucumisin, ii) Arabidopsis thaliana Ara12, iii) Alnus glutinosa ag12, iv) members of the tomato P69 family, and v) tomato LeSBT2. However, these proteins belong to other subtilisin-like subgroups. Relatively little is known about proteins in this subgroup.
238300	PA	1.95e-11	715	797	28	115	PA: Protease-associated (PA) domain. The PA domain is an insert domain in a diverse fraction of proteases. The significance of the PA domain to many of the proteins in which it is inserted is undetermined. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Proteins into which the PA domain is inserted include the following: i) various signal peptide peptidases including, hSPPL2a and 2b which catalyze the intramembrane proteolysis of tumor necrosis factor alpha, ii) various proteins containing a C3H2C3 RING finger including, Arabidopsis ReMembR-H2 protein and various E3 ubiquitin ligases such as human GRAIL (gene related to anergy in lymphocytes), iii) EDEM3 (ER-degradation-enhancing mannosidase-like 3 protein), iv) various plant vacuolar sorting receptors such as Pisum sativum BP-80, v) glutamate carboxypeptidase II (GCPII), vi) yeast aminopeptidase Y, vii) Vibrio metschnikovii VapT, a sodium dodecyl sulfate (SDS) resistant extracellular alkaline serine protease, viii) lactocepin (a cell envelope-associated protease from Lactobacillus paracasei subsp. paracasei NCDO 151), ix) various subtilisin-like proteases such as melon Cucumisin, and x) human TfR (transferrin receptor) 1 and 2.
239047	PA_GO-like	3.74e-11	681	806	11	139	PA_GO-like: Protease-associated domain containing proteins like Arabidopsis thaliana growth-on protein GRO10. This group contains various PA domain-containing proteins similar to the functionally uncharacterized Arabidopsis GRO10. The PA domain may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS05465.1|GH47	1.32e-267	54	619	1	567
QRW05174.1|GH47	4.61e-190	40	778	45	790
QRV76268.1|GH47	3.14e-186	40	778	45	790
BAC29890.1|GH47	7.59e-175	38	498	3	476
AFE70442.1|GH47	2.97e-174	38	498	54	527

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	2.62e-47	53	486	11	447	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	2.96e-47	53	486	16	452	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	3.09e-47	53	486	16	452	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
5KK7_A	1.31e-46	53	486	11	447	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1X9D_A	1.33e-46	53	486	94	530	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q92611|EDEM1_HUMAN	3.33e-174	38	498	121	594	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens OX=9606 GN=EDEM1 PE=1 SV=1
sp|Q925U4|EDEM1_MOUSE	5.65e-174	38	498	116	589	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1
sp|O94726|MNL1_SCHPO	1.54e-157	38	675	26	656	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2
sp|Q6GQB9|EDEM3_XENLA	8.20e-131	31	766	22	724	ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Xenopus laevis OX=8355 GN=edem3 PE=2 SV=2
sp|Q2HXL6|EDEM3_MOUSE	7.59e-128	29	795	31	777	ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Mus musculus OX=10090 GN=Edem3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.193097	0.806878	CS pos: 38-39. Pr: 0.7415

TMHMM  Annotations     

Start	End
21	40