CAZyme Information: ORE09609.1

Basic Information

• Species: Rhizopus microsporus
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus microsporus
• CAZyme ID: ORE09609.1
• CAZy Family: GT34
• CAZyme Description: pectin lyase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	KV921874|CGC1	39955.25	9.1179

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmicrosporusATCC52814	11554	N/A	58	11496

• Gene Location: location=KV921874:125886-127075(-)

Full Sequence      

MVQLLSLSSTVAAFLLLSLGINDVAAAKTCVVAKTGNDDTAAIVKAFNDCKTGGIVSFPK
GKSYNLNGMIELSGLKDVTIDFQGQIVLPSWDKKYKGGNSYISIKGSNIHMSGGGTIVGN
GQGWYDRQDHTAPTVIRFGATNSVFGNFKIVNAPRAHMGITGSNNVVLENIYLNTASSSK
NPPKNTDALDISSSSNIVFRNSELNIGDDCTAINGGVTNVTLSHIKCNGGHGFSVGSLGK
GGKQESVKLVRVLDSVCTNCQNGVRIKTWPGGKGVVQDVVYKNVQLNNVENPVIVTTHYC
DKNQMSFCTKNNDSSLSISKVTFDTITGSVAGKKPAISIDCSKNTPCSGFTLSNINIKSN
GAKNVCNNLSGSNKISYCS

Enzyme Prediction     

EC	3.2.1.15:24

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	47	370	1.6e-69	0.9661538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.63e-56	50	368	1	314	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	2.41e-51	38	374	82	423	polygalacturonase ADPG
215426	PLN02793	3.31e-50	78	364	111	401	Probable polygalacturonase
215540	PLN03010	8.54e-43	38	371	61	391	polygalacturonase
178580	PLN03003	3.22e-41	38	376	38	382	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAD67423.1|GH28|3.2.1.15	1.10e-154	1	379	1	382
ACA48699.1|GH28|3.2.1.15	1.10e-154	1	379	1	382
CDS05517.1|GH28	8.48e-124	12	378	8	379
CDS12141.1|GH28	3.30e-76	28	378	26	395
CDS14149.1|GH28	1.60e-54	28	357	24	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	8.30e-36	35	363	27	366	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1IA5_A	8.57e-32	27	369	1	333	Polygalacturonase From Aspergillus Aculeatus [Aspergillus aculeatus],1IB4_A Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus],1IB4_B Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus]
1HG8_A	2.74e-31	41	367	9	341	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]
6KVH_A	1.24e-29	39	369	15	338	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
6KVE_A	1.24e-29	39	369	15	338	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1BPS7|RPG13_RHIO9	4.19e-140	1	379	1	362	Exopolygalacturonase rpg13 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) OX=246409 GN=rpg13 PE=1 SV=1
sp|I1BYN6|RPG16_RHIO9	4.14e-138	1	379	1	384	Exopolygalacturonase rpg16 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) OX=246409 GN=rpg16 PE=1 SV=1
sp|I1BYM7|RPG15_RHIO9	3.35e-127	1	379	1	384	Exopolygalacturonase rpg15 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) OX=246409 GN=rpg15 PE=1 SV=1
sp|I1BYN5|RPG14_RHIO9	8.75e-127	1	379	1	372	Exopolygalacturonase rpg14 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) OX=246409 GN=rpg14 PE=1 SV=1
sp|Q00359|PGLRX_COCCA	3.30e-52	28	371	54	429	Exopolygalacturonase OS=Cochliobolus carbonum OX=5017 GN=PGX1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000385	0.999604	CS pos: 26-27. Pr: 0.9642

TMHMM  Annotations     

There is no transmembrane helices in ORE09609.1.