CAZyme Information: ORE09581.1

Basic Information

• Species: Rhizopus microsporus
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus microsporus
• CAZyme ID: ORE09581.1
• CAZy Family: GT33
• CAZyme Description: pectin lyase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332	KV921874|CGC2	35836.22	9.3467

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmicrosporusATCC52814	11554	N/A	58	11496

• Gene Location: location=KV921874:64717-65770(-)

Full Sequence      

MQLSLGYLTLVLLCVQLVFAGTVNVCSSCAFKSISKAITSLPNNSESYTVLIAPGTYTEQ
FTIARPNLVLKPTSGSVTIQFASGHDTSSKTGSTADSAVLTITGKNVILQDIIIANTYKQ
GRVANVALHLNAPQAYFKNVKIYGFQDTLLINRDGAGYFDNCYIEGSVDFIWGFGTGYFS
NSVIASNQRGTSVTAHGRDTPNGPGGFYFNQCTFKATVPSGPLSKTYDPSISFSSPSQFE
NTCFFARPWGKYSRVIITNSSIGSHIKPAGWSAWSDASPNTANVVYGEYKNFGARPWTSA
RASFAKNLTPEQASQYSAAKVFGGNTSWFQNR

Enzyme Prediction     

No EC number prediction in ORE09581.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	23	322	1.6e-71	0.9791666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	6.27e-46	28	325	9	298	Pectinesterase.
215357	PLN02665	4.15e-42	31	316	80	348	pectinesterase family protein
178051	PLN02432	4.52e-42	31	330	23	293	putative pectinesterase
215170	PLN02301	1.41e-39	31	330	248	538	pectinesterase/pectinesterase inhibitor
178113	PLN02497	3.62e-35	31	331	44	328	probable pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK47705.1|CE8	5.58e-58	31	328	91	380
QKD59401.1|CE8	2.74e-45	31	328	1168	1459
UPK95982.1|CE8	6.83e-45	31	331	1794	2084
CCT74155.1|CE8	1.26e-44	31	328	1107	1398
QGI68927.1|CE8	1.26e-44	31	328	1132	1423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	4.14e-28	31	331	15	306	Chain A, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	4.23e-27	31	330	19	309	Pectin methylesterase from Carrot [Daucus carota]
5C1E_A	1.09e-26	20	301	8	271	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.51e-26	20	301	8	271	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	7.87e-25	31	323	18	335	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9SIJ9|PME11_ARATH	2.12e-30	31	330	61	333	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1
sp|Q43043|PME_PETIN	5.59e-28	21	330	59	361	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1
sp|Q9ZQA3|PME15_ARATH	2.32e-27	31	331	101	387	Probable pectinesterase 15 OS=Arabidopsis thaliana OX=3702 GN=PME15 PE=2 SV=1
sp|Q96575|PME22_SOLLC	3.10e-27	31	331	248	539	Pectinesterase 2.2 OS=Solanum lycopersicum OX=4081 GN=PME2.2 PE=3 SV=1
sp|Q8LPF3|PME68_ARATH	1.19e-26	22	332	62	360	Probable pectinesterase 68 OS=Arabidopsis thaliana OX=3702 GN=PME68 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000186	0.999774	CS pos: 20-21. Pr: 0.9831

TMHMM  Annotations     

There is no transmembrane helices in ORE09581.1.