CAZyme Information: ORE09356.1

Basic Information

• Species: Rhizopus microsporus
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus microsporus
• CAZyme ID: ORE09356.1
• CAZy Family: GT24
• CAZyme Description: Glycosyltransferase-like protein LARGE1 [Source:UniProtKB/TrEMBL;Acc:A0A1X0RBI0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
515	KV921877|CGC1	59258.95	9.0158

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmicrosporusATCC52814	11554	N/A	58	11496

• Gene Location: location=KV921877:159680-161402(-)

Full Sequence      

MNIRDERGSSFERIIKRTRRSIWFKFRRTSRLHLVALFTLLTLLYFFLNRSTSLKKKSKI
TTLGNQPTYEQHNTSCFATLCNPSNKCSTWLPNRPYDWSELSQAGIFRDLATIQVEFGCE
LKIKLESERSEWMTLPTGKKVNCEGYDTKCGNLVAIDLKANILILAIQLKQKMQDPSTEG
QEIVMVHHGQESSNRNVDVSLISQFSVNRLEPFVEVIESWQGPISVAIYLTQSTDIDTLV
QFLKTSKNLDLYSRLTITLIKPNYLDPEHLAYPINNLRNIAITQSTTEYIFVTDADFVPS
NNLYTFIRSRLIPYVIYQSGKIPPTAWVVPCFAIREAYAQLPIPNTYNELRRLVGQNVAY
ITDPGAGHGPTLAVEIAMVRPLLMGNPLAYEVCYESQWEPYYVLHRSAPLYDVRFRNQGG
DKQSHALHLNAEKYRFMVLREVFMVHRDHSKMIWPSGGFEKSQKEAKTWNYFNEFMNEIQ
SIYGRNSRWPRGCSAMAIGWQDQRRDVVGLAAGAV

Enzyme Prediction     

EC	2.4.1.-:23	2.4.2.-:23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	182	487	2.1e-51	0.8694362017804155

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	3.91e-39	198	483	1	326	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.
133035	GT_2_like_e	0.004	281	360	77	162	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS10282.1|GT49	2.77e-145	63	512	85	528
CRX78931.1|GT49	3.24e-65	95	495	118	564
CDR43695.1|GT49	1.05e-62	198	495	207	554
AES00982.1|GT49	9.67e-30	183	450	42	293
AWO97858.1|GT49|GT8	4.79e-29	183	450	304	555

PDB Hits     

ORE09356.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9Z1M7|LARG1_MOUSE	6.21e-29	183	450	458	709	Xylosyl- and glucuronyltransferase LARGE1 OS=Mus musculus OX=10090 GN=Large1 PE=1 SV=1
sp|Q66PG2|LARG1_DANRE	8.34e-29	183	484	459	744	Xylosyl- and glucuronyltransferase LARGE1 OS=Danio rerio OX=7955 GN=large1 PE=2 SV=1
sp|Q5XPT3|LARG2_MOUSE	1.29e-28	198	450	402	639	Xylosyl- and glucuronyltransferase LARGE2 OS=Mus musculus OX=10090 GN=Large2 PE=1 SV=1
sp|Q66PG4|LARG2_CHICK	3.47e-28	198	450	456	692	Xylosyl- and glucuronyltransferase LARGE2s OS=Gallus gallus OX=9031 GN=LARGE2 PE=2 SV=1
sp|Q6P7A1|LARG2_RAT	4.18e-28	198	450	401	639	Xylosyl- and glucuronyltransferase LARGE2 OS=Rattus norvegicus OX=10116 GN=Large2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000017	0.000004

TMHMM  Annotations     

Start	End
29	48