CAZyme Information: ORE08334.1

Basic Information

• Species: Rhizopus microsporus
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus microsporus
• CAZyme ID: ORE08334.1
• CAZy Family: GT2
• CAZyme Description: Ncstrn_small domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1X0R8P8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1215	KV921890|CGC1	136516.36	7.3926

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmicrosporusATCC52814	11554	N/A	58	11496

• Gene Location: location=KV921890:99626-104166(-)

Full Sequence      

MIPLTAENVAHYLPLSGQSPHIKGRIIHVTHQIPYNILRAQHTDHQLPLSPPRSPSSKYP
PPMPALDEPSSSDAVAAAPISKLARHHRRGTTLRMRFHAADWTVVERRGHQALYAGLQSL
RKDYETIHIGWTGPIKEQGTCKLITPNKLALEDKVKLQALLWETAHVIPVFLDEKSHGHY
EGYCKQVLWPVFHYLERSSSCSSRVEKSYWDDYVAVNRQFAKTVIDRYQPNDIIFINDYH
LLLVPEMIREALPDAAIGIFIHVTFPSSEVFRCLQTRNEILQGILGANLAGFQTYSYARH
FISSCTRVLGCETTQIGVSHHGTLISVGTFPIGVDCARVSQFSKQPGVRPKMNAIRDMHS
GKKIIAGRDKLDSTKGILQKLHAFEGFLRDYPEWRNKIVLIQVATPTHGDHSKLEAKISE
TVSHINGKYGSLEYTPIHYYHQDIDRDEYYALLSVADLLLITCSRDGMNTTSYEYVLCQH
HKNEPGQLILSEFTGTAGSMSAAILVNPWDYAEVAKSINDALTMSLDEKVTRHEQLYRHV
TSRTADFWAHSFIKQLVTISQQHDLQSRATPTLNSPKLLTDYKAAKKRIMFFDYDGTLTP
IVSVPSAATPSPEMLKALQGLCNDPKNIVWVISGRDQATLDEWLGNNIKNIGLSAEHGCY
VKPVGSSKWQSVVDGLDMSWKSDVIEIFDYYTERTQGSFVEHKKSSVTWHYRQADAEYGA
FQAKECQNHLENAIVSKYPVEILVGKKNLEVRPMSINKGEIVKRILSKNPDTNLVICAGD
DKTDEDMFRALSSAHQSPSSVWPERDSHLYSITWAEDIATTLYPHIYTNLNNWPCVKLLN
ATGTIGCHSLKKKSGVLYQANTTQDLDNFIHNNSLTNDAAVILTLDLLTTSNLEQLIQTK
KVAGIIVLVKNELNNTNIPSPDSTCPNCQFGLYANDSDPYQWNSQALNLIEQSFDIPIFA
IKPIDDISNNVYNQINQAVAYNAEKQYRQYPLKAVDFDLFMWAAVNAKTCLRRDDNKPII
VVSSKLDSRALFHDLTIGASKDISGLVAVLAVAEALSRAPVVLDTLPKHILYTLFTAEDW
AFAGSQRFVKDITSPFECTNATRAIPCPYLNATCTFPCVRNADFKRIRFDKIESVFEFQS
VSGINSDYMGYYIHVDDQELNQPLVASLEKYPGLKSASSDGIQRKLPPSSAMSFLQQSRK
IKAAVITDYQSKLGK

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	100	556	9.7e-162	0.9305263157894736

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	113	791	30	690	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	0.0	101	556	18	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	0.0	101	556	23	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215556	PLN03064	5.67e-180	122	788	132	807	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
215555	PLN03063	2.15e-171	122	788	49	717	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJH76892.1|GT20	0.0	1	813	1	803
CDS06611.1|GT20	0.0	3	794	8	835
CDS09548.1|GT20	0.0	4	791	3	762
CDS13004.1|GT20	2.02e-292	102	794	46	736
CDS07232.1|GT20	3.65e-255	18	792	19	782

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXF_A	3.84e-130	102	560	57	527	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
6JBI_A	2.70e-109	113	556	30	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVM_A	6.44e-106	113	560	42	478	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HVO_A	1.53e-103	113	560	41	478	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUT_A	3.96e-103	113	566	34	477	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78875|TPP1_SCHPO	1.22e-180	101	791	58	770	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|P31688|TPS2_YEAST	1.30e-179	101	805	35	806	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|Q54K57|TPSA_DICDI	2.46e-177	113	813	46	709	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q9P4D3|TPS2_ZYGRO	2.23e-173	101	805	30	809	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|Q54NU9|TPSB_DICDI	1.08e-166	152	791	110	750	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ORE08334.1.