CAZyme Information: ORE08107.1

Basic Information

• Species: Rhizopus microsporus
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus microsporus
• CAZyme ID: ORE08107.1
• CAZy Family: GT15
• CAZyme Description: L-ascorbate oxidase [Source:UniProtKB/TrEMBL;Acc:A0A1X0R7S1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527		59417.25	5.9711

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmicrosporusATCC52814	11554	N/A	58	11496

• Gene Location: location=KV921893:45606-47189(-)

Full Sequence      

MAILMAVVPAEAKKRTFELNIQPTLLNPDCFNQSYAVLTVNGQYPAPTVRVVVGDTVEFI
IKNSGESNVSTSVHIHGILQFGTNQADGVAGITQVPVAPGCEYRQEFQIVNQTGTFYYHA
HVGVQDDSIQGSFIVYEREESLIKAEKEMLSEGLIQEGPFEYHEERILLWSEWWHQSMYD
RQAYYTSPTFDGDTGPDSILLNGKSVYENCTMENCPGFAMIDVKPNSTYRLRNIGGLTFR
VLGLFIQHHNMTLIELDGEYVQPQLIDHLELTPGQRSSVLIQTGNYPDGTLFPIASFYKW
SFNYHKTYSPSGFGYIRYVSDKTKSASAIRVTDAPKNLPITTPPQDHGWILRDLKPINHS
NPTILTTSPSRTIKLSMAQVKMPDNTTQFQNNGRVHKPWGNDTASLLDIIKADPDPGPLD
PIDGFSVKHQTYPVKLGEVIDIVFQNMKNEAGLCVTHPWHTHGYSHYLIAEGPGDYDHDE
HKSIFTYQQPLLRDVSMQYLWPDIPGERPCGWIKIRLYAVSLVMAKV

Enzyme Prediction     

No EC number prediction in ORE08107.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	35	517	6.8e-71	0.9106145251396648

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	7.52e-66	14	519	1	497	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
132431	ascorbOXfungal	1.73e-64	35	517	28	503	L-ascorbate oxidase, fungal type. This model describes a family of fungal ascorbate oxidases, within a larger family of multicopper oxidases that also includes plant ascorbate oxidases (TIGR03388), plant laccases and laccase-like proteins (TIGR03389), and related proteins. The member from Acremonium sp. HI-25 is characterized.
215324	PLN02604	2.48e-58	10	519	20	520	oxidoreductase
177843	PLN02191	8.52e-55	1	517	10	518	L-ascorbate oxidase
259868	CuRO_2_LCC_like	3.47e-41	166	318	1	152	Cupredoxin domain 2 of laccase-like multicopper oxidases; including laccase, CueO, spore coat protein A, ascorbate oxidase and similar proteins. Laccase-like multicopper oxidases (MCOs) are able to couple oxidation of substrates with reduction of dioxygen to water. MCOs are capable of oxidizing a vast range of substrates, varying from aromatic compounds to inorganic compounds such as metals. Although the members of this family have diverse functions, majority of them have three cupredoxin domain repeats. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 2 of 3-domain MCOs has lost the ability to bind copper.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS12532.1|AA1	2.99e-131	13	521	26	544
CDS06551.1|AA1	9.75e-119	15	518	26	613
CDS07261.1|AA1	1.67e-102	11	523	19	525
CDS06185.1|AA1	4.72e-95	17	519	18	539
AIG56331.1|AA1	1.28e-59	27	522	43	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1AOZ_A	1.88e-46	15	519	4	497	Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution [Cucurbita pepo var. melopepo],1AOZ_B Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution [Cucurbita pepo var. melopepo],1ASO_A X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASO_B X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASP_A X-ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-forms [Cucurbita pepo var. melopepo],1ASP_B X-ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-forms [Cucurbita pepo var. melopepo],1ASQ_A X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASQ_B X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo]
1ZPU_A	2.64e-33	33	494	20	437	Crystal Structure of Fet3p, a Multicopper Oxidase that Functions in Iron Import [Saccharomyces cerevisiae],1ZPU_B Crystal Structure of Fet3p, a Multicopper Oxidase that Functions in Iron Import [Saccharomyces cerevisiae],1ZPU_C Crystal Structure of Fet3p, a Multicopper Oxidase that Functions in Iron Import [Saccharomyces cerevisiae],1ZPU_D Crystal Structure of Fet3p, a Multicopper Oxidase that Functions in Iron Import [Saccharomyces cerevisiae],1ZPU_E Crystal Structure of Fet3p, a Multicopper Oxidase that Functions in Iron Import [Saccharomyces cerevisiae],1ZPU_F Crystal Structure of Fet3p, a Multicopper Oxidase that Functions in Iron Import [Saccharomyces cerevisiae]
3FPX_A	5.89e-29	18	495	7	425	Native fungus laccase from Trametes hirsuta [Trametes hirsuta],3V9C_A Type-2 Cu-depleted fungus laccase from Trametes hirsuta at low dose of ionization radiation [Trametes hirsuta]
6KLG_A	8.91e-29	37	521	24	506	Crystal Structure of the Zea Mays laccase 3 [Zea mays],6KLI_A Crystal Structure of the Zea Mays laccase 3 complexed with sinapyl [Zea mays],6KLJ_A Crystal Structure of the Zea Mays laccase 3 complexed with coniferyl [Zea mays]
3PXL_A	1.08e-28	18	495	7	425	Type-2 Cu-depleted fungus laccase from Trametes hirsuta [Trametes hirsuta]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P37064|ASO_CUCPM	9.67e-46	15	519	4	497	L-ascorbate oxidase OS=Cucurbita pepo var. melopepo OX=3665 PE=1 SV=1
sp|P24792|ASO_CUCMA	3.50e-44	15	519	34	527	L-ascorbate oxidase OS=Cucurbita maxima OX=3661 GN=AAO PE=1 SV=2
sp|P14133|ASO_CUCSA	3.90e-44	13	519	37	533	L-ascorbate oxidase OS=Cucumis sativus OX=3659 PE=1 SV=1
sp|Q8LPL3|ASO_ARATH	4.11e-43	28	516	37	514	L-ascorbate oxidase OS=Arabidopsis thaliana OX=3702 GN=AAO PE=1 SV=1
sp|Q40588|ASO_TOBAC	8.28e-43	12	516	28	521	L-ascorbate oxidase OS=Nicotiana tabacum OX=4097 GN=AAO PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000010

TMHMM  Annotations     

There is no transmembrane helices in ORE08107.1.