CAZyme Information: ORE07308.1

Basic Information

• Species: Rhizopus microsporus
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus microsporus
• CAZyme ID: ORE07308.1
• CAZy Family: GT1
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1X0R5V0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
538	KV921906|CGC2	59534.81	6.4490

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmicrosporusATCC52814	11554	N/A	58	11496

• Gene Location: location=KV921906:39643-41334(-)

Full Sequence      

MLFSISLYFILFHIAFAITKIPFTDPNIQYIGRWQSTSNDIQSGWPGAYFKVVLKGTYTV
KVQLSKPANVLIQIDDGPSSFFGNTTPTIDLIPFPDNEQHQVLVVATEVISLQSILIEDT
GQTIPFISKGIVEFVGHDLILGTETSRGPLSSFAWITSDMIDMDHIHIAYSGATLINGLS
TRYFDMWPPQQMKQQQHTSTKPCAVVVLLGTNDKHKGYASPDYRDTLTSFLTRVRQRLSN
PDVPIFVLSEPLGDMFRPSQQAVVSLNRQGELHTYFIDTTGWVRHGPSLYNEKGYLNDAG
HELFAKRLSPFLEAKINDPRQPLPGPAPNPNLPGDWQTMDVGDEIRIGLPGTVSADSSTT
FTLWGSGADIDDTSDAFRFMYQPFSGSGTLESTIRSHSTFAKCAKAGIMIREHLGSGSPL
IMLGISPADGVFVQVRYRNFGPTKIIKTMKATPPYRLRLTRQSEDLFEAHIQHIDLLGVK
TEWEPFASIAVTMSKDVYAGLAVTSCDTTVVSVAKFTDVTLYHSSSLTSIPKLVNQQA

Enzyme Prediction     

No EC number prediction in ORE07308.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	150	312	2.2e-18	0.84688995215311

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	8.47e-15	132	313	2	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
238863	SGNH_hydrolase_peri1	4.50e-08	176	308	32	181	SGNH_peri1; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	4.08e-07	201	303	61	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
239946	SGNH_hydrolase_like_7	8.64e-07	151	312	8	171	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238866	sialate_O-acetylesterase_like2	6.68e-05	198	313	45	169	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATB41364.1|CBM42|CBM66|CE0	1.58e-40	24	370	42	407
QEV23757.1|CE2	2.05e-37	24	364	44	404
QYX75407.1|CE2	9.74e-37	24	372	44	413
ADO71607.1|CBM42|CBM66|CE0	2.20e-36	24	312	41	345
ULR55324.1|CE2	4.79e-36	24	372	44	424

PDB Hits     

ORE07308.1 has no PDB hit.

Swiss-Prot Hits     

ORE07308.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000327	0.999668	CS pos: 17-18. Pr: 0.9788

TMHMM  Annotations     

There is no transmembrane helices in ORE07308.1.