CAZyme Information: ORE06414.1

Basic Information

• Species: Rhizopus microsporus
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus microsporus
• CAZyme ID: ORE06414.1
• CAZy Family: GH5
• CAZyme Description: CBM21 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1X0R345]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
280		33312.69	9.2332

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmicrosporusATCC52814	11554	N/A	58	11496

• Gene Location: location=KV921923:1478-2320(+)

Full Sequence      

MSFYNKRIVLKRSIPYQPIYKQDNKKKSVRFNPDLEQTIYFYKTQPPKAIHIKDVIRAED
YTMTQINWPNKTRLLLYNDNKIRMEQIQLTDGDYQDIEKNQFMMEGRCRALNISYQKTVS
VRYTFDLWSTYHETVSVFKESIASTSNTWDRFTFTIPIQASNQVQTIYFALRYTVDGQEY
WDNNNGLNYQIIITPPPLPLHEKEKEQQQKIKKLSKRYDFSHSYYSPPPSPPITPTELPL
YTPFQDNKTELSYTDFVNKYCFYNSHSSLIYSTSPSAVFT

Enzyme Prediction     

No EC number prediction in ORE06414.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	95	191	4.6e-26	0.8785046728971962

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	2.15e-29	78	191	3	112	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	1.64e-10	112	191	1	75	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS05148.1|CBM21	9.96e-41	25	265	86	375
CDS02860.1|CBM21	1.76e-33	26	191	64	224
UKZ51116.1|CBM21	1.88e-16	13	191	217	407
ACP93043.1|CBM21	2.59e-16	13	202	81	273
AUB26447.1|CBM21	9.47e-16	12	191	324	501

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2EEF_A	2.37e-11	106	192	50	136	Chain A, Protein phosphatase 1, regulatory (Inhibitor) subunit 3B [Homo sapiens]
2M83_A	1.44e-09	84	192	24	134	Solution structure of the carbohydrate binding module of the muscle glycogen-targeting subunit of Protein Phosphatase-1 [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T1SFR8|PPR3C_CLABA	3.13e-11	104	194	153	243	Protein phosphatase 1 regulatory subunit 3C OS=Clarias batrachus OX=59899 GN=PPP1R3C PE=2 SV=1
sp|Q7TMB3|PPR3C_MOUSE	5.33e-11	106	192	171	257	Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus OX=10090 GN=Ppp1r3c PE=1 SV=1
sp|O95685|PPR3D_HUMAN	1.18e-10	104	191	189	277	Protein phosphatase 1 regulatory subunit 3D OS=Homo sapiens OX=9606 GN=PPP1R3D PE=1 SV=1
sp|Q8BRJ4|PPR3E_MOUSE	3.43e-10	106	192	176	259	Protein phosphatase 1 regulatory subunit 3E OS=Mus musculus OX=10090 GN=Ppp1r3e PE=1 SV=2
sp|Q86XI6|PPR3B_HUMAN	6.59e-10	106	192	147	233	Protein phosphatase 1 regulatory subunit 3B OS=Homo sapiens OX=9606 GN=PPP1R3B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ORE06414.1.