CAZyme Information: ORE05791.1

Basic Information

• Species: Rhizopus microsporus
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus microsporus
• CAZyme ID: ORE05791.1
• CAZy Family: GH38
• CAZyme Description: Polysaccharide lyase family 14 protein [Source:UniProtKB/TrEMBL;Acc:A0A1X0R1D7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304	KV921937|CGC1	34410.42	10.4821

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmicrosporusATCC52814	11554	N/A	58	11496

• Gene Location: location=KV921937:92484-93565(+)

Full Sequence      

MVYRLFVFYVAILIVLLSAVNASSDPLTHTLEKRGVKKWTFWNWNKYKKAIVGEQSKWST
TWGIHKHRGWLWAWSGSENENAAVRDPSKKTKDLVLRVKYTAKSRNPEIHPIGGVGFLAE
PLSITAKSKKVTLQYSVFFPKGFDFVKGGKLPGLYGGHGECTGGDESGSCFTTRLMWRTD
GEGEIYAYLPNSKQRKNLCDNKINICNPDYGFSLGRGTFHFKTGTWTTVRQELVLNSQGK
RNGQMSLYVNGVRKINVKNVAFRSSSTGHVVGIMFHTFFGGSDSTWRTPKDQYSYFKNFI
LKVS

Enzyme Prediction     

EC	4.2.2.26:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL14	126	300	4.5e-62	0.8341013824884793

CDD Domains     

ORE05791.1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS05384.1|PL14_3	2.75e-101	39	304	30	289
CDS02791.1|PL14_3	2.64e-91	30	301	19	285
BAL22352.1|PL14|4.2.2.3	2.56e-59	78	303	60	282
ABO26618.1|CBM2|PL14	9.61e-58	78	301	174	389
AFQ98374.1|PL14	1.30e-54	65	303	28	263

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GMT_A	5.33e-46	88	301	51	270	Crystal structure of the marine PL-14 alginate lyase from Aplysia kurodai [Aplysia kurodai],5GMT_B Crystal structure of the marine PL-14 alginate lyase from Aplysia kurodai [Aplysia kurodai]
3A0N_A	7.85e-18	69	302	16	241	Crystal structure of D-glucuronic acid-bound alginate lyase vAL-1 from Chlorella virus [Paramecium bursaria Chlorella virus CVK2],3GNE_A Crystal structure of alginate lyase vAL-1 from Chlorella virus [Paramecium bursaria Chlorella virus CVK2],3GNE_B Crystal structure of alginate lyase vAL-1 from Chlorella virus [Paramecium bursaria Chlorella virus CVK2],3IM0_A Crystal structure of Chlorella virus vAL-1 soaked in 200mM D-glucuronic acid, 10% PEG-3350, and 200mM glycine-NaOH (pH 10.0) [Paramecium bursaria Chlorella virus CVK2]
6KCW_A	9.70e-12	112	302	54	238	Structure of alginate lyase Aly36B [Chitinophaga sp. MD30]
6KCV_A	1.53e-10	112	302	54	238	Structure of alginate lyase Aly36B mutant K143A/Y185A in complex with alginate tetrasaccharide [Chitinophaga sp. MD30],6KCV_B Structure of alginate lyase Aly36B mutant K143A/Y185A in complex with alginate tetrasaccharide [Chitinophaga sp. MD30],6KCV_C Structure of alginate lyase Aly36B mutant K143A/Y185A in complex with alginate tetrasaccharide [Chitinophaga sp. MD30]
6KZK_A	3.69e-10	112	302	54	238	Structure of alginate lyase Aly36B mutant K143A/M171A in complex with alginate trisaccharide [Chitinophaga sp. MD30],6KZK_B Structure of alginate lyase Aly36B mutant K143A/M171A in complex with alginate trisaccharide [Chitinophaga sp. MD30],6KZK_C Structure of alginate lyase Aly36B mutant K143A/M171A in complex with alginate trisaccharide [Chitinophaga sp. MD30]

Swiss-Prot Hits     

ORE05791.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000206	0.999766	CS pos: 22-23. Pr: 0.9816

TMHMM  Annotations     

Start	End
5	24