CAZyme Information: ORE05216.1

Basic Information

• Species: Rhizopus microsporus
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus microsporus
• CAZyme ID: ORE05216.1
• CAZy Family: GH28
• CAZyme Description: UDP-glucose:glycoprotein glucosyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A1X0QZQ3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1544	KV921950|CGC1	176214.45	5.0003

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmicrosporusATCC52814	11554	N/A	58	11496

• Gene Location: location=KV921950:42444-47935(+)

Full Sequence      

MLRISTAILGLVTLSGLLSKAYASSPTVDLTLVAPWFAPDFLLEVAETIAVHNEESYYRF
IDTIRTHQEPYNWTPQKVYEEAVKAAASLKEIDVDLLKLSLSLHEAAPRIEAYFQYYNQL
VTANLTEYDQQCDVWVHIGNKQVCDLELLTDTIQDLKDTAYVNLLPFDHITDDTLQKPTV
VLYTDSFSAKFNIFYTWLKDAADQHKIAYIIRYRPPVSDSMKKPLYLSGYGVEMALKKTD
YLVIDDRKTQDDKPQHVLKEKLLNFGKKLNHALFDTTEEASIQPLTPSKIGQLGLKAAQY
IAKSNNPLETMSLLAQDFPKYAKSISMIELDKEFENEVLENQYSSVQGGLNAVWINGKAL
ELRQVDPFYLARLLRDEKKLIQSIQAIGFSSREAIELISNPILSEGESMGNDIISGVYDV
RDTPENPFVVWWNDIEKDTQYEDWPSNIMEILKPTYPGQLHPIRKNIYNLLLVEDLASTA
SLSRIVNEIQTMIKRTIPIRFGLIALVEDDNSASTLMARALYYLVKNNGKGDAIKFLETI
LELTSSNGLDRATTEMIERAFNGHMSIAHETLSSEQVIDQSQAFITATRQFMKRMGISQS
KPNEGTMFMNGKLLEFDEERPWVHSLMPHLTEQTRFIQTMAYNQEFDPDLDYYEYTLSQP
NVVQKRNPYILVSHTNPLRMHTFDAITESKGLKYFQNDHESFVKTNLWVVSDFDTANGLK
LLLEAILFAEANPKVRVAFIHKSIYKAPTKDTNEPEFSDLLCKLIYEQDTNLATLKEILQ
KTNLFADVDGSNSSQKPGEVAIQINGDGLEPVPIIPGTPITEIVTEAQREKWSNLNTALV
KDGLEPDFTGIIMNGRVIGPLSLSENIQFTNQDFETLYQYENAKRIMHVEKAIIESEKDL
QNNTSDAVMKLTAIIENDKAQATQDVIESHEPVHRRRQYQKIPRTQYTQFTAGNYSDDTF
LEIGLIIDPLSEAAQKIAPIVYTLSEIEGVSVVTYLNPVSTLQELPLKRFYRYVFDKEPH
FDTNTGEKQVPTAYFANLPVKPLYTLGVETTNAWHVTVKEANMDLDNILLTSIPDNQHGV
SAVYELQSILVEGHCLDSINKSPPRGLEFELISPSGLDKKDTLVMANLGYFQLKASPGIW
KLALREGRSSSVYSIQDVGANGKWNWNTEFNGSKKIDDTLALISFEGLTITPLVHKNPGM
EDEDVLEPAQPKSKENTGGLWSSINQKIFGKKETESALSLTNKATNAEINIFSVASGKLY
ERFLSIMMASVMKHTKSTVKFWFIENFLSPEFKDFVPHMAKEYGFDYEMVTYKWPAWLRA
QHEKQRTIWGYKILFLDVLFPLSLNKVIFVDADQIVRTDLKELIDMDLHGAPYGYTPFCS
DRTEMDGFRFWKEGYWKNHLRGKPYHISALYVVDLVRFRQLAAGDRLRAQYQQLSADPNS
LANLDQDLPNNMQHIVPIYSLPQEWLWCETWCSDESLKKAKTIDLCNNPLTKEPKLDRAR
RQVPEWETYDKEIDELRKRITADGSSNLPKQDKPFIKEHLKDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1249	1496	3.7e-136	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1249	1516	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	0.0	1249	1496	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408201	Thioredoxin_14	2.84e-72	418	670	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
132996	Glyco_transf_8	2.73e-61	1249	1496	1	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
399437	UDP-g_GGTase	5.13e-50	1092	1207	1	109	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS05797.1|GT24	0.0	17	1520	8	1443
QGA15584.1|GT24	0.0	7	1522	5	1461
QKX56539.1|GT24	0.0	24	1524	25	1466
AOZ60530.1|GT24	0.0	23	1526	23	1485
QDS71787.1|GT24	0.0	6	1544	10	1504

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	2.93e-313	23	1520	6	1451	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	1.15e-312	23	1520	6	1451	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	2.29e-312	23	1520	6	1451	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	6.46e-272	25	1458	1	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	1.17e-266	23	1520	6	1217	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	3.13e-278	17	1532	12	1440	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	3.91e-264	2	1516	21	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9NYU2|UGGG1_HUMAN	1.20e-263	8	1520	27	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q9JLA3|UGGG1_RAT	4.52e-262	17	1516	36	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	2.46e-255	2	1527	7	1518	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000236	0.999725	CS pos: 23-24. Pr: 0.9711

TMHMM  Annotations     

There is no transmembrane helices in ORE05216.1.