CAZyme Information: ORE03092.1

Basic Information

• Species: Rhizopus microsporus
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus microsporus
• CAZyme ID: ORE03092.1
• CAZy Family: GH125
• CAZyme Description: Glycosyl transferase [Source:UniProtKB/TrEMBL;Acc:A0A1X0QTM7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
727	KV922018|CGC1	85126.81	6.9027

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmicrosporusATCC52814	11554	N/A	58	11496

• Gene Location: location=KV922018:21499-24720(+)

Full Sequence      

MDCMPKDQAIQWIHSLFGSCVYGYAELSSQLFGYTSLFCWLCAQLPQMVENYQLQSADGL
SLYLLYFWLAGDVANTVSCILNRQLPFQIYLAFYFCMTDLVLLFQYFYYRKIETTPILST
SPTYGSVKNSKRQLLALFLVFGFKSQSSLVVDSVVLGRLLAWACTTFYLSSRIPQIIKNH
KRHSVEGLSLALFSFAVPQLNSRLVRLISLVFLIACLLFLFKYIIHLEERNSLLKEQEEE
QNRLLLKQEKEREQERRKQLEIEREKKRMQKILENRAIVEPEITVENTIDLIDKYYVAVP
TPIESWKDDDLQLLKSPIGQRFAADLFTTTDSQDKPDFKLLTSKQRIFKSLFQYFDPIIA
EGLVDVTKEPAYKETWAIYSKLENSLYPWIKPFWKNAFKINTTIKQDKGIVMCVGEDQFK
HAASAVRALRQVLKSDLPIEIFYINQDDLSKSKRDYFETFENVKTVDISTIINDEYTQFG
GWAIKPYAMLASSFRHVILMDADVFMFQKPDTLFEDEGYKRTGALFFLDRTLFNNYEEGR
RWLKSFLPTYSTYVEQSRWWKKTSAHEQESGIVVMDKKKVLFGLLSTCKMNDKQERDMVS
YKHSHGDKETFWTGFEMVQTPYLFPRSYGAVLGGLGDSGAAGTVCGNQLHLDTNKRPWWW
NGGLLRDKNRWENRYLMFTHYAEGEDWQFETSCIKEKDRIYELNEHEKEIGEKLIELDKE
RKKADDI

Enzyme Prediction     

No EC number prediction in ORE03092.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	408	649	8.6e-53	0.9772727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	4.64e-46	408	652	2	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
398045	PQ-loop	1.89e-17	29	88	2	61	PQ loop repeat. Members of this family are all membrane bound proteins possessing a pair of repeats each spanning two transmembrane helices connected by a loop. The PQ motif found on loop 2 is critical for the localization of cystinosin to lysosomes. However, the PQ motif appears not to be a general lysosome-targeting motif. It is thought likely to possess a more general function. Most probably this involves a glutamine residue. Family members are membrane transporters since two members, cystinosin and PQLC2, transport cystine and cationic amino acids, respectively, across the lysosomal membrane. The 2nd PQ-loop of cystinosin hosts the substrate-coupled H+ binding site underlying its H+ symport mechanism, suggesting that PQ-loop repeats have functional significance. It is thus likely that PQ-loop-containing proteins act as a family of membrane transporters. Some transport cystine and cationic amino acids, respectively, across the lysosomal membrane. Others transport lysine and or arginine across the lysosomal membrane in order to maintain the acidic homoeostasis.
398045	PQ-loop	5.48e-10	156	193	1	38	PQ loop repeat. Members of this family are all membrane bound proteins possessing a pair of repeats each spanning two transmembrane helices connected by a loop. The PQ motif found on loop 2 is critical for the localization of cystinosin to lysosomes. However, the PQ motif appears not to be a general lysosome-targeting motif. It is thought likely to possess a more general function. Most probably this involves a glutamine residue. Family members are membrane transporters since two members, cystinosin and PQLC2, transport cystine and cationic amino acids, respectively, across the lysosomal membrane. The 2nd PQ-loop of cystinosin hosts the substrate-coupled H+ binding site underlying its H+ symport mechanism, suggesting that PQ-loop repeats have functional significance. It is thus likely that PQ-loop-containing proteins act as a family of membrane transporters. Some transport cystine and cationic amino acids, respectively, across the lysosomal membrane. Others transport lysine and or arginine across the lysosomal membrane in order to maintain the acidic homoeostasis.
130026	2A43	5.28e-05	27	190	2	172	Lysosomal Cystine Transporter. [Transport and binding proteins, Amino acids, peptides and amines]
128923	CTNS	8.90e-05	171	197	2	28	Repeated motif present between transmembrane helices in cystinosin, yeast ERS1p, mannose-P-dolichol utilization defect 1, and other hypothetical proteins. Function unknown, but likely to be associated with the glycosylation machinery.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS05902.1|GT71	1.52e-195	267	723	61	517
CDS14050.1|GT71	4.07e-182	276	727	64	519
UJR24372.1|GT71	7.88e-55	382	710	156	493
UJR24360.1|GT71	1.81e-53	337	710	107	501
CDR35835.1|GT71	1.15e-51	379	691	133	463

PDB Hits     

ORE03092.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q95XZ6|LAAT1_CAEEL	7.55e-24	8	197	21	241	Lysosomal amino acid transporter 1 OS=Caenorhabditis elegans OX=6239 GN=laat-1 PE=1 SV=2
sp|Q6ZP29|LAAT1_HUMAN	2.00e-19	9	197	18	224	Lysosomal amino acid transporter 1 homolog OS=Homo sapiens OX=9606 GN=SLC66A1 PE=1 SV=1
sp|P53745|MNT4_YEAST	1.48e-18	391	671	182	492	Probable alpha-1,3-mannosyltransferase MNT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT4 PE=3 SV=1
sp|Q06328|YPQ2_YEAST	2.48e-18	19	194	2	222	Probable vacuolar amino acid transporter YPQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YPQ2 PE=1 SV=1
sp|Q5ZJX0|LAAT1_CHICK	1.62e-17	11	197	22	230	Lysosomal amino acid transporter 1 homolog OS=Gallus gallus OX=9031 GN=SLC66A1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998323	0.001665

TMHMM  Annotations     

Start	End
12	34
60	82
89	108
149	171
204	226