CAZyme Information: ORE02988.1

Basic Information

• Species: Rhizopus microsporus
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus microsporus
• CAZyme ID: ORE02988.1
• CAZy Family: CE4
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
611	KV922023|CGC1	68806.81	8.4351

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmicrosporusATCC52814	11554	N/A	58	11496

• Gene Location: location=KV922023:24514-26576(-)

Full Sequence      

MLARESPSSVFPAISHPYPPIYADTSFKKPVPTNSWISNLFYPSTGNLAPTTPDPYILRL
LDDFGGNPGLSISQPSQKVIGSYSSMNNVPETPAGYIVNGVVVDFRVTSAEWKDQRPEPL
ITNWDLFGTNIRLQSKSGSIDFPVARGMSYVTALYNDLTPQFFTQHAILQVSSDMFQSND
TYTGRKFKLSFNDNPTSTFIIYALGKEPLTLQKIGNNNLVAVNKYNGPIQVTKLPSKESE
IVLDFNRGTWATGGDIKLDLNRNSYTIEWKQGGNRSKNLLMYAYPHHMKSFIRDGSLKKT
NLKLQSSTKGIMQAVVGNVWTLLEKNVSSIDWLPSNPTPEASTRNEIMENLVSDVRLNYT
EETLKGDNYFSGKGLQKLAILSLLLNKPNQTALKNQELAEESLNKIKAAFLPYLENRQMD
PFRYDALYKGVVSLNGLPTELGGTGNRDAAFGHSYYNDHHYHQGYLIVTAAIIHYLDPVW
NTNQIRKWTEALIQDVNCQASDNADFAQFRNWDWFAGHSWAGGIKVNGALDGRDQESVPE
SVNFYWGVKLWGLATKNTDLVKLANLQLAVMKRATYEYFWMLDSNENRPPAMVKNKVAGI
FFEQKIDYVRN

Enzyme Prediction     

No EC number prediction in ORE02988.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	16	608	1.1e-131	0.8408360128617364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	1.01e-108	6	608	65	658	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	6.80e-89	341	608	4	258	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	7.00e-58	16	337	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGV00786.1|GH81	4.85e-276	7	608	42	650
CDS06153.1|GH81	4.41e-272	2	608	26	636
UJR31943.1|GH81	3.94e-92	8	608	49	621
AIU47331.1|GH81	2.86e-89	2	608	96	686
AIU47330.1|GH81	2.86e-89	2	608	96	686

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	7.06e-278	7	608	17	625	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.68e-277	7	608	42	650	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	2.88e-272	7	608	17	625	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	8.55e-16	267	582	249	538	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.32e-10	229	608	219	586	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	3.73e-79	10	608	15	605	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	4.40e-77	30	608	225	801	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	2.52e-73	6	608	56	640	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q12168|ENG2_YEAST	9.12e-67	5	608	85	681	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|P53753|ENG1_YEAST	8.24e-55	2	608	406	1014	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000015

TMHMM  Annotations     

There is no transmembrane helices in ORE02988.1.