CAZyme Information: ORE02941.1

Basic Information

• Species: Rhizopus microsporus
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus microsporus
• CAZyme ID: ORE02941.1
• CAZy Family: CE4
• CAZyme Description: Glycosyltransferase family 49 protein [Source:UniProtKB/TrEMBL;Acc:A0A1X0QT77]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330	KV922025|CGC1	38927.21	6.9622

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmicrosporusATCC52814	11554	N/A	58	11496

• Gene Location: location=KV922025:23562-24606(+)

Full Sequence      

MGPGKVIPYYFKATDTFDSEDISIATLVTHNRFPVLSRLATRYKGPISAAIHVNDDHEKH
TILNDLHSMYQANPDMARFVDIHLIVDKFDRQFNMWRNAAKLFARTEYIMMLDVDFHLCT
DFRQSLKRHTEVMDKLRQGKGAVVIPAFEFIVEQDGEDWRTFPTEKNDLMTIVQQGKIDM
FHLGWTRGHGSTNYSKWYESSQPYKVTDYNYSYEPYVIYKKEGSPWCDERFIGYGANKAA
CLYEIYLAGIDYWVLPDDFLIHQTHHYPEDTRAKERKYNKKLYDYYREEACLRYSRLMIS
AGLWETSEADNLKRECNKIKGFKEIVGRVL

Enzyme Prediction     

No EC number prediction in ORE02941.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	15	285	3.7e-46	0.8041543026706232

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	8.30e-53	21	294	1	326	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS14203.1|GT49	6.94e-199	1	329	98	427
CDS06289.1|GT49	7.60e-193	1	329	96	424
CDS06217.1|GT49	1.80e-172	1	324	106	429
CDS09884.1|GT49	1.32e-171	1	323	65	387
CDS10115.1|GT49	2.10e-165	1	323	101	423

PDB Hits     

ORE02941.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5XPT3|LARG2_MOUSE	3.32e-27	21	265	402	638	Xylosyl- and glucuronyltransferase LARGE2 OS=Mus musculus OX=10090 GN=Large2 PE=1 SV=1
sp|Q6P7A1|LARG2_RAT	1.11e-26	21	265	401	638	Xylosyl- and glucuronyltransferase LARGE2 OS=Rattus norvegicus OX=10116 GN=Large2 PE=2 SV=1
sp|O95461|LARG1_HUMAN	1.19e-26	18	265	470	708	Xylosyl- and glucuronyltransferase LARGE1 OS=Homo sapiens OX=9606 GN=LARGE1 PE=1 SV=1
sp|Q9Z1M7|LARG1_MOUSE	5.38e-26	10	265	462	708	Xylosyl- and glucuronyltransferase LARGE1 OS=Mus musculus OX=10090 GN=Large1 PE=1 SV=1
sp|Q66PG3|LARG1_CHICK	5.38e-26	18	265	470	708	Xylosyl- and glucuronyltransferase LARGE1 OS=Gallus gallus OX=9031 GN=LARGE1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ORE02941.1.