CAZyme Information: ORE02303.1

Basic Information

• Species: Rhizopus microsporus
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus microsporus
• CAZyme ID: ORE02303.1
• CAZy Family: CE4
• CAZyme Description: concanavalin A-like lectin/glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
223	KV922059|CGC1	25692.01	6.6408

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmicrosporusATCC52814	11554	N/A	58	11496

• Gene Location: location=KV922059:21643-22408(+)

Full Sequence      

MDYTVPPKQNYTLARVFSPQNIEMDAYGLSLRVKNQKDKYTSAAIGTRRSDILYGTFRAR
MKTSQIAGTVAAFYYYRNTTSEIDIETLSKLRNPAQVYFAIQPQIYNPDGSASPQTHHRY
PMPFDPTQEYHEYRFDWMPGLVKFYIDGLFVRDMTINVPETPGRIMINHWTDGNPNFSGG
PPEEDADLIVSHLNMFFNSSEQIEPPPCQKSKEPCKVQGIFFF

Enzyme Prediction     

No EC number prediction in ORE02303.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	17	194	5.9e-63	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	1.43e-45	2	190	12	204	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	2.44e-26	17	180	1	160	Glycosyl hydrolases family 16.
185684	GH16_lichenase	6.49e-24	18	185	30	199	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185692	GH16_fungal_CRH1_transglycosylase	5.92e-15	28	176	25	170	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185685	GH16_XET	1.72e-11	3	152	2	145	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS07094.1|GH16_23	3.14e-78	1	220	67	293
CDS07155.1|GH16_23	5.18e-57	3	220	87	309
QKX60960.1|GH16_23	2.30e-39	45	200	135	296
QDS77245.1|GH16_23	2.90e-39	20	219	85	290
QLI71737.1|GH16_23	2.94e-38	19	201	41	236

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CPN_A	5.79e-17	54	211	14	175	NATIVE-LIKE IN VIVO FOLDING OF A CIRCULARLY PERMUTED JELLYROLL PROTEIN SHOWN BY CRYSTAL STRUCTURE ANALYSIS [Paenibacillus macerans]
1GBG_A	3.36e-16	21	170	38	184	Bacillus Licheniformis Beta-Glucanase [Bacillus licheniformis]
3O5S_A	3.59e-16	21	170	62	208	Crystal Structure of the endo-beta-1,3-1,4 glucanase from Bacillus subtilis (strain 168) [Bacillus subtilis]
3WVJ_A	7.18e-16	54	170	74	186	Chain A, Beta-glucanase [Acetivibrio thermocellus ATCC 27405],3WVJ_B Chain B, Beta-glucanase [Acetivibrio thermocellus ATCC 27405]
1MAC_A	8.70e-16	54	170	70	182	Crystal Structure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans],1MAC_B Crystal Structure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07980|GUB_BACAM	9.75e-16	21	170	63	209	Beta-glucanase OS=Bacillus amyloliquefaciens OX=1390 GN=bglA PE=3 SV=1
sp|Q84C00|GUB_ACETH	1.52e-15	54	170	103	215	Beta-glucanase OS=Acetivibrio thermocellus OX=1515 GN=licB PE=1 SV=1
sp|P04957|GUB_BACSU	1.96e-15	21	170	66	212	Beta-glucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=bglS PE=1 SV=2
sp|P27051|GUB_BACLI	2.76e-15	21	170	67	213	Beta-glucanase OS=Bacillus licheniformis OX=1402 GN=bg1 PE=1 SV=1
sp|P23904|GUB_PAEMA	6.70e-15	54	170	95	207	Beta-glucanase OS=Paenibacillus macerans OX=44252 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000025	0.000038

TMHMM  Annotations     

There is no transmembrane helices in ORE02303.1.