CAZyme Information: ORE01041.1

Basic Information

• Species: Rhizopus microsporus
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus microsporus
• CAZyme ID: ORE01041.1
• CAZy Family: AA2
• CAZyme Description: glycosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
746		85396.36	6.9252

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmicrosporusATCC52814	11554	N/A	58	11496

• Gene Location: location=KV922194:3303-5611(+)

Full Sequence      

MPKLTRRLTNVIIHVDDDKSEPVTPASVPSRPSYRLKLDEQAISNWKKHIIPEKNDVDSI
ENDIVHHTITTLCRGVYNVDAWAIYQATAHSVRDRLLEDWNITQEALHKQNPKRCYYLSM
EFLLGRALDNALNSLHVKDNYKESVKNLGFNLEDLLSQEKDPALGNGGLGRLAACYMDSA
ATQDYPTWGYGLRYQYGIFKQIIKDGYQTEMPDYWLNFNNPWEFPRTDIRYEVRFGGYVA
TKVNEKGESRMSWEGGSKVQAMAYDMPIPGFNTKFCGNIRLWASKPLNTFDFDSFNAGDY
DRSVAEQNNAQNLTSVLYPNDNHLVGKELRLKQEYFFVCASLQDIIHRFKRAKCPWKDFP
SKVAIQMNDTHPTLAVPELQRILVDIEGLDWDDAWDIVTHTFGFTNHTVLPEALERWSVP
LMEKILPRHMQIIYDINLFFLQKVEKEYLGDRELLKRVSIIEESSPQQVRMAHLAVVGSH
KVNGVAALHSDLIKKHLFSDFIKYYGPEKFINITNGITPRRWLYQANPGLRDLITKTLGG
SEQWVTHLNLLEGLKQHADNSEFQEQWAAVKLDNKRRLAGWIKDNLNVNVDPHALFDIQV
KRIHEYKRQLMNILGVIYRYKQLKKMSAQELDEAVPRVVIFGGKAAPGYYIAKLVIKLIN
SVAEVVNQDEDIENKLKVIFIPDYNVSRAELIIPASDISQHISTAGTEASGTSNMKFVLN
GGLILGTVDGANIEIAEQIVSWSHGR

Enzyme Prediction     

EC	2.4.1.1:158

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	145	741	1.9e-242	0.8189910979228486

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223136	GlgP	0.0	84	739	33	620	Glucan phosphorylase [Carbohydrate transport and metabolism].
237881	PRK14985	0.0	108	739	54	671	maltodextrin phosphorylase; Provisional
273967	P_ylase	0.0	84	739	21	669	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
340853	GT35_Glycogen_Phosphorylase	0.0	62	739	2	670	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
395272	Phosphorylase	0.0	145	739	1	537	Carbohydrate phosphorylase. The members of this family catalyze the formation of glucose 1-phosphate from one of the following polyglucoses; glycogen, starch, glucan or maltodextrin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD89946.1|GT35	0.0	23	739	39	751
QMW43077.1|GT35	0.0	23	739	39	751
QMW31026.1|GT35	0.0	23	739	39	751
QUC19999.1|GT35	6.45e-318	33	739	52	757
UKZ73690.1|GT35	1.29e-317	46	739	64	756

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1YGP_A	1.46e-292	2	739	1	751	Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae],1YGP_B Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae]
4BQE_A	6.33e-246	52	739	55	743	Arabidopsis thaliana Cytosolic Alpha-1,4-glucan Phosphorylase (PHS2) [Arabidopsis thaliana],4BQE_B Arabidopsis thaliana Cytosolic Alpha-1,4-glucan Phosphorylase (PHS2) [Arabidopsis thaliana],4BQF_A Arabidopsis thaliana cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with acarbose [Arabidopsis thaliana],4BQF_B Arabidopsis thaliana cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with acarbose [Arabidopsis thaliana],4BQI_A ARABIDOPSIS THALIANA cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with maltotriose [Arabidopsis thaliana],4BQI_B ARABIDOPSIS THALIANA cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with maltotriose [Arabidopsis thaliana]
5LR8_A	1.40e-233	56	739	28	795	Structure of plastidial phosphorylase Pho1 from Barley [Hordeum vulgare subsp. vulgare],5LR8_B Structure of plastidial phosphorylase Pho1 from Barley [Hordeum vulgare subsp. vulgare],5LRA_A Plastidial phosphorylase PhoI from barley in complex with maltotetraose [Hordeum vulgare subsp. vulgare],5LRA_B Plastidial phosphorylase PhoI from barley in complex with maltotetraose [Hordeum vulgare subsp. vulgare],5LRB_A Plastidial phosphorylase from Barley in complex with acarbose [Hordeum vulgare subsp. vulgare],5LRB_B Plastidial phosphorylase from Barley in complex with acarbose [Hordeum vulgare subsp. vulgare]
3ZCP_A	7.92e-231	85	738	53	703	Rabbit muscle glycogen phosphorylase b in complex with N- cyclohexancarbonyl-N-beta-D-glucopyranosyl urea determined at 1.83 A resolution [Oryctolagus cuniculus]
5OX0_A	7.92e-231	85	738	53	703	Glycogen Phosphorylase in complex with CK898 [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00766|PHS1_DICDI	5.81e-300	54	739	38	720	Glycogen phosphorylase 1 OS=Dictyostelium discoideum OX=44689 GN=glpV PE=1 SV=3
sp|P06738|PHSG_YEAST	5.43e-295	1	739	23	774	Glycogen phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPH1 PE=1 SV=4
sp|P34114|PHS2_DICDI	7.45e-263	51	739	107	786	Glycogen phosphorylase 2 OS=Dictyostelium discoideum OX=44689 GN=glpD PE=1 SV=2
sp|Q9SD76|PHS2_ARATH	1.10e-245	52	739	22	710	Alpha-glucan phosphorylase 2, cytosolic OS=Arabidopsis thaliana OX=3702 GN=PHS2 PE=1 SV=1
sp|P53537|PHSH_VICFA	9.58e-242	58	739	31	711	Alpha-glucan phosphorylase, H isozyme OS=Vicia faba OX=3906 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ORE01041.1.