CAZyme Information: ORE00949.1

Basic Information

• Species: Rhizopus microsporus
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus microsporus
• CAZyme ID: ORE00949.1
• CAZy Family: AA1
• CAZyme Description: pectin lyase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332		36241.08	9.6759

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmicrosporusATCC52814	11554	N/A	58	11496

• Gene Location: location=KV922213:3558-4615(+)

Full Sequence      

MQFSLGYLTLALLCVQLVFAGTISVCNSCQYKSISKAIASLPNNAESYTVLIAPGTYTEQ
FTIARSNLVLKPASGTVTIQYASGHDPNAKTGSTADSAVLTITGKNVMMQDIIIANTLKQ
TRVANVALHVNAPQAYFKNVKIYGFQDTLLINRSGSAYFKNCWIEGSVDFIWGFGTGYFD
KCVIASNQKGTSVTAQGNDSANAPGGFYFNHCVFKATVPSGPLSKTYNPSMAFTSPAQFP
DSCYLGRPWRSYARVIIMNSDLGNHIKPAGWSEWPTSTPDTRNVLYGEYKNFGARPWTSA
RVKFSKNLSDNQAAQFTAKKVFGGNTSWFQNR

Enzyme Prediction     

No EC number prediction in ORE00949.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	27	322	7.9e-78	0.9652777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	2.39e-52	28	325	9	298	Pectinesterase.
215357	PLN02665	2.49e-49	31	316	80	348	pectinesterase family protein
178051	PLN02432	7.42e-45	31	330	23	293	putative pectinesterase
215170	PLN02301	1.65e-44	28	330	245	538	pectinesterase/pectinesterase inhibitor
178113	PLN02497	2.79e-38	31	331	44	328	probable pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK47705.1|CE8	3.97e-58	31	328	91	380
QKD59401.1|CE8	9.56e-49	30	328	1167	1459
QPC60527.1|CE8	9.41e-47	30	328	1066	1359
CCT74155.1|CE8	9.43e-47	30	328	1106	1398
QGI68927.1|CE8	9.44e-47	30	328	1131	1423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.39e-35	31	331	15	306	Chain A, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	5.69e-34	31	330	19	309	Pectin methylesterase from Carrot [Daucus carota]
5C1E_A	2.02e-32	20	301	8	271	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.82e-32	20	301	8	271	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	1.69e-27	31	323	18	335	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9SIJ9|PME11_ARATH	3.80e-36	31	324	61	328	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1
sp|Q9LUL8|PME26_ARATH	7.22e-35	22	328	662	957	Putative pectinesterase/pectinesterase inhibitor 26 OS=Arabidopsis thaliana OX=3702 GN=PME26 PE=2 SV=1
sp|Q43043|PME_PETIN	8.36e-34	21	330	59	361	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1
sp|P14280|PME1_SOLLC	2.22e-33	31	331	244	535	Pectinesterase 1 OS=Solanum lycopersicum OX=4081 GN=PME1.9 PE=1 SV=5
sp|Q96575|PME22_SOLLC	2.30e-33	30	331	247	539	Pectinesterase 2.2 OS=Solanum lycopersicum OX=4081 GN=PME2.2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000204	0.999780	CS pos: 20-21. Pr: 0.9822

TMHMM  Annotations     

There is no transmembrane helices in ORE00949.1.