CAZyme Information: OON09923.1

Basic Information

• Species: Batrachochytrium salamandrivorans
• Lineage: Chytridiomycota; Chytridiomycetes; ; NA; Batrachochytrium; Batrachochytrium salamandrivorans
• CAZyme ID: OON09923.1
• CAZy Family: GT58
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1S8W786]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
195	LYON01000101|CGC1	21369.55	7.7619

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BsalamandrivoransBS	10186	N/A	51	10135

• Gene Location: location=LYON01000101:51-860(-)

Full Sequence      

MISVLTALLAACSAVSLIVPVCAGSSNTGNCLTGRITFDGTRMIPLYGSTSVETRQAVDV
SKYDMSLDTGFIEYLSTRGIKMNLKRGPDGAGIITSLSTTRYSLYGRFTVRMKAPSTPGI
VTTFITMSERKDEIDWEIIGSRPGFAETNVFYKGIKEMGIHGGKHAIESPNGISDYHQYT
IDWRPDVLTYVMLPF

Enzyme Prediction     

No EC number prediction in OON09923.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	95	191	1.1e-27	0.5402298850574713

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	1.34e-31	61	189	8	130	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	2.92e-25	95	191	23	120	Glycosyl hydrolases family 16.
185683	Glyco_hydrolase_16	3.65e-14	90	190	55	158	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185685	GH16_XET	1.19e-11	90	191	37	139	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.
185684	GH16_lichenase	9.42e-11	79	190	40	154	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADK37842.1|GH16_19	2.65e-19	31	192	67	217
QSS56628.1|CBM18|GH16_19	9.69e-18	75	190	107	217
QSS71477.1|CBM18|GH16_19	3.42e-17	75	190	107	217
CDI51277.1|CBM18|GH16_19	1.09e-16	59	192	100	237
QSS61834.1|CBM18|GH16_19	1.63e-16	88	190	119	217

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	2.61e-12	87	190	45	153	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WI46|CRF2_ASPFU	7.32e-19	95	190	126	220	Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf2 PE=1 SV=1
sp|Q5AFA2|CRH11_CANAL	6.10e-13	77	190	67	174	Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRH11 PE=1 SV=1
sp|Q75A41|CRR1_ASHGO	7.01e-12	60	183	156	273	Probable glycosidase CRR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=CRR1 PE=3 SV=1
sp|Q5AK54|CRH12_CANAL	7.32e-12	76	192	78	197	Extracellular glycosidase CRH12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRH12 PE=1 SV=1
sp|D4B4J2|CRH12_ARTBC	8.18e-12	69	186	66	176	Probable extracellular glycosidase ARB_03382 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03382 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004655	0.995340	CS pos: 23-24. Pr: 0.6865

TMHMM  Annotations     

There is no transmembrane helices in OON09923.1.