CAZyme Information: OON08452.1

Basic Information

• Species: Batrachochytrium salamandrivorans
• Lineage: Chytridiomycota; Chytridiomycetes; ; NA; Batrachochytrium; Batrachochytrium salamandrivorans
• CAZyme ID: OON08452.1
• CAZy Family: GT31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349		41266.09	8.8493

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BsalamandrivoransBS	10186	N/A	51	10135

• Gene Location: location=LYON01000252:16371-17420(-)

Full Sequence      

MRIFRITIICRLFLLVLLAGILFIWYTASWSSYLWSRPVWGPAAIRVSHLCENCTADPDP
LIPRIIHQTWKDEYIPKKWQKAHGACNYWHPRSNWTHYFWTDSDARELIKAVDPEFLKIF
DGYRYPIQRVDAVRYFILYEFGGIYMDLDIGCLKCLEPLLRYPAIIPKTTPIGFSNDFMA
SRPKHPMFKQMVEALPSSNQNLILPYATVFFSTGPMFLNMHVKNYLHKEQPLSPDTKIEY
DTRVAKDANNQTYIKSMPKITDTDSVWVLEPLLYSGGRPHSFFMHFEGNSWHSADAVFIL
KFWSLISQKWTWLETLCFCMFCLFVFALFTYYRTCKRRFSLDVKTRRVD

Enzyme Prediction     

No EC number prediction in OON08452.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	78	160	8e-19	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	8.99e-44	54	275	74	298	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.61e-15	76	160	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR87151.1|GT32	1.46e-59	56	300	120	348
CBQ71693.1|GT32	8.83e-59	56	300	122	350
SJX61564.1|GT32	2.37e-58	57	300	123	350
CDI52367.1|GT32	2.86e-58	57	300	93	320
SAM79788.1|GT32	4.85e-58	56	300	118	346

PDB Hits     

OON08452.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14084|IMT1_SCHPO	9.15e-54	42	299	43	270	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q10323|IMT3_SCHPO	1.72e-53	62	331	57	290	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	2.51e-50	58	299	58	267	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	2.90e-50	53	296	45	256	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	3.29e-45	59	300	79	290	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999348	0.000682

TMHMM  Annotations     

Start	End
12	34
310	332