CAZyme Information: OON08435.1

Basic Information

• Species: Batrachochytrium salamandrivorans
• Lineage: Chytridiomycota; Chytridiomycetes; ; NA; Batrachochytrium; Batrachochytrium salamandrivorans
• CAZyme ID: OON08435.1
• CAZy Family: GT3
• CAZyme Description: Chitin synthase [Source:UniProtKB/TrEMBL;Acc:A0A1S8W1Z5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1800		198676.06	7.6739

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BsalamandrivoransBS	10186	N/A	51	10135

• Gene Location: location=LYON01000254:13974-20551(-)

Full Sequence      

MRPGRKPVGKANEASIGSTSNIYDLSQYRQGTSGADTVHPMNAESISRVLSKKLQLGRTA
YLKVGDRVLVAARPICQDSLGSATAVDVASDTLSKDRAAHLRSLGKALLKSPKLQSLPTV
TPDPHIFDLAGSALIHLLNDRQDQCIVLSGVSNSGKSESGRLIARHLSDLSRNTSGTKKT
KIHSAAIKMDFVLSAFGNAASPQNIHGSHFSRYTEYQFNDDGAMIGVKLLTYNLEKQRIT
DACDLHANFNVFYYLLAGCGLEMRTKFSLTEASGFHYLNRVQSKPPIVSPQHHFSPDNLN
LLSDHLKAVGIPKKTHMDIFQLLAGILHLGNINFVRTSGSANQPCTTKNPQQMEITASLL
GLKPEHLLSTLTFETKAIGRELCTTILDIEGAIRQRDTLAQLLYGLLFQWITEHINARYC
REESEWTHYISVVDFQGIQTSSPGTGRCLARLVSNYAAERVHDYVVSHLFKATKTLLSEN
AIRGDARSKSLSLSSLESNSDVLHILSAPTTGIITLIQNESMRLERSMSPSSSESSSALN
SSDLVDRIFKSNVNNSKLLTYPSAQKKFGILHYIGAVEYDVFATARYNDISAGTSISTDF
ISLFCGSMDQPATQFALARQLFSKRAITVDLHPKNRLTLMRARLSIMSTRRPSTLRKRNT
LKLGSSKPTGVSAVSQGDPDSSAFIGGNVPFSASVDTSLDAGHTSILNTSRFSFPKNEGY
ATGISSAEPTDSLLLDQTRLTMDDLLESLTDTNMWFAMHICPQGNVRGINIDSHEMSRQV
KALQLDTLTASCGILYVLEIPFEELLLRTESLSVPLLTHAVHKGGPQPHAYTLLEKSIHV
LDYIGIPSDLYILGDYKIFFTEAASRMLYSSLNNGLLLRELSAGDSSTPEYVANLAGVSR
GRPSAGQNAVSGNPVTADNASDYEDHDHGPSTHLIASDNTRQQRKGGVNFRAASMAASAT
SLHTAEDDPYEVDSMYDFTFFAEGGPELNGVPQLTIDQPSSLKHVVSPHGTDINLGDYKA
SSGLPNQGTELDMSRQSPTDASSSPTKPRTRSRRIWMCCTWGMTWWIPTPFISYVFKKRR
PDVQIAWREKVALCFIIFLMCATMLFLIVGLGQVVCPKQNILSEGEVSTLNTLANPYVIL
YGGYYHISDVVKTHVQSSSSFIASAAFVSTTLGRDVSAMFNPTLIPKKYCPNLTLPPGWD
NVYQRSNQGTPQTWYSHQNLRNPTATPTDYIGSMAYMKKGQVARSNDWISSYILADSSHR
IIVAWGKVYDISAYYDASNVGALADGPGFFGPLVKQIFDAFSRPANLGHDATSTINQLQQ
PQYGGPVAFANFRACMDGLFMTGVPDTRSSLRCVLPNYIMLAASIVMVSVIGFKFLGALQ
LTSKVNPENHLKFVICQVPCYTEDEDSLKKTIDSIACTQYDDRHKLLFIVCDGMIIGAGN
DRPTPRIVLDILGVDPDVDPESHSFQSLGVGLREHNMGKIFSGLYDVQGRLVPFIVVVKT
GTPLERNRPGNRGKRDSQLVLMRFLNRVHFNAPLAPLEIELMRHMKHIIGVDPALYEYVL
MVDADTMVFPDSLNLLISSMIVDGKIVGICGETRLSNEQASWVTMIQVYEYYISHHLSKA
FESLFGTVACLPGCFCLYRIRSSSTSRQVPLLVSPQVLNDYSENTVDTLHMKNLLELGED
RYLTTLMLKHFPALKTKFVAGALCQTGAPETWSVFLSQRRRWINSTVHNLFELVFLTEMC
GFCCFSMRFVIFIDLFATFLQPSALIYIVYLVCCICISFFLFSQYGVIFVSKEALHDCKL

Enzyme Prediction     

EC	2.4.1.16:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	1370	1778	3e-189	0.8026565464895635

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367353	Chitin_synth_2	0.0	1368	1772	1	420	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
276845	MYSc_Myo17	1.75e-111	61	653	20	555	class XVII myosin, motor domain. This fungal myosin which is also known as chitin synthase uses its motor domain to tether its vesicular cargo to peripheral actin. It works in opposition to dynein, contributing to the retention of Mcs1 vesicles at the site of cell growth and increasing vesicle fusion necessary for polarized growth. Class 17 myosins consist of a N-terminal myosin motor domain with Cyt-b5, chitin synthase 2, and a DEK_C domains at it C-terminus. The chitin synthase region contains several transmembrane domains by which myosin 17 is thought to bind secretory vesicles. The catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.
133033	Chitin_synth_C	8.21e-78	1395	1729	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
276950	MYSc	9.93e-73	124	581	55	494	Myosin motor domain superfamily. Myosin motor domain. The catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. CyMoBase classifications were used to confirm and identify the myosins in this hierarchy.
214580	MYSc	1.11e-72	124	623	73	532	Myosin. Large ATPases. ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW25802.1|GT2	6.01e-290	56	1772	31	1640
QRV98874.1|GT2	2.31e-288	56	1772	38	1645
CDS08031.1|GT2	2.97e-285	61	1772	39	1581
AZQ26801.1|GT2	1.09e-284	25	1772	8	1635
QDK64613.1|GT2	1.09e-284	25	1772	8	1635

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1MMD_A	1.45e-45	124	581	153	581	Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mgadp-Bef3 [Dictyostelium discoideum],1MND_A Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mgadp-Alf4 [Dictyostelium discoideum],1MNE_A Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mg-Pyrophosphate [Dictyostelium discoideum],1VOM_A Complex Between Dictyostelium Myosin And Mgadp And Vanadate At 1.9a Resolution [Dictyostelium discoideum]
1W9L_A	2.08e-45	124	581	153	581	Myosin II Dictyostelium discoideum motor domain S456E bound with MgADP-AlF4 [Dictyostelium discoideum]
3MKD_A	2.14e-45	124	581	152	580	Crystal structure of myosin-2 dictyostelium discoideum motor domain S456Y mutant in complex with adp-orthovanadate [Dictyostelium discoideum]
1D0X_A	2.54e-45	124	581	153	581	Chain A, MYOSIN S1DC MOTOR DOMAIN [Dictyostelium discoideum],1D0Y_A Chain A, MYOSIN S1DC MOTOR DOMAIN [Dictyostelium discoideum],1D0Z_A Chain A, MYOSIN [Dictyostelium discoideum],1D1A_A Chain A, MYOSIN [Dictyostelium discoideum],1D1B_A Chain A, MYOSIN [Dictyostelium discoideum],1D1C_A Chain A, MYOSIN [Dictyostelium discoideum]
1MMA_A	2.57e-45	124	581	153	581	X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain [Dictyostelium discoideum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4P9K9|CHS8_USTMA	4.27e-281	44	1772	19	1643	Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS8 PE=3 SV=1
sp|J9VNT4|CHS5_CRYNH	1.62e-263	124	1769	96	1628	Chitin synthase 5 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS5 PE=2 SV=1
sp|O13395|CHS6_USTMA	5.27e-203	1048	1772	65	785	Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS6 PE=3 SV=2
sp|J9VF17|CHS4_CRYNH	1.79e-196	1050	1772	160	884	Chitin synthase 4 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS4 PE=2 SV=2
sp|O13353|CHS4_MAGO7	6.34e-114	1391	1772	682	1078	Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CHS4 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000001

TMHMM  Annotations     

Start	End
1054	1076
1093	1115
1354	1376
1730	1752
1767	1789