CAZyme Information: OON06551.1

Basic Information

• Species: Batrachochytrium salamandrivorans
• Lineage: Chytridiomycota; Chytridiomycetes; ; NA; Batrachochytrium; Batrachochytrium salamandrivorans
• CAZyme ID: OON06551.1
• CAZy Family: GT2
• CAZyme Description: Dolichyl-phosphate-mannose--protein mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A1S8VWC2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
439		48933.59	9.8091

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BsalamandrivoransBS	10186	N/A	51	10135

• Gene Location: location=LYON01000553:11184-14230(+)

Full Sequence      

MSLRRPTAPSLQPPLSLEPPRHARRPSSVMSDHSGPLSSASGSARRESQSHHPNWLPSPY
GREPKPAFFAYSERRGPQVVSMGIILLLTLLATAVRLYNLQEPPQVVFDEVHFGGFATKY
INSEFFMDVHPPLGKLIVAGSGVLLGYNGSFSFQTIGLSYIDANVPYVAMRGVPAFMGAL
LSPIAYTTMRNFGFSSTASVLTSILVMFENAFVCQFRLILLDSFLVFFTGLTAMLWTEFR
RVYDRPFSPLWWRTLAFTGIGLGLTISVKWVGLFTIALIGVATLQDLWDLVTNGTVPVRV
FFRHFMARAICLIIVPLAVYAFFFHIHFSVLYKKGTGSGFMSPEFQSTLFGSEVEDTRAD
VAYGSKIALRHEATRGGYLHSHPHNYPDGSKQQQMTCYPFRDENSWFLIKPKLGFKNATA
IDSVSTGFDRLTHGSIVRL

Enzyme Prediction     

EC	2.4.1.109:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	88	328	1.9e-66	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	4.87e-108	95	439	37	371	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	1.07e-72	95	332	10	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
197746	MIR	7.28e-13	360	411	3	56	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.
224720	ArnT	1.68e-04	105	282	40	191	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
226796	COG4346	0.003	119	301	130	277	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09314.1|GT39	1.68e-116	84	439	113	460
QSS58982.1|GT39	2.01e-108	85	410	63	393
AAW43214.1|GT39	6.72e-108	88	439	72	425
ADV24240.1|GT39	9.61e-108	88	439	73	426
CCA73422.1|GT39	1.65e-107	54	438	63	466

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_B	2.75e-77	81	438	64	425	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_A	7.40e-74	84	439	52	399	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P28_A	1.35e-09	360	438	5	89	Crystal structure of the MIR domain (aa 337-532) of the S. cerevisiae mannosyltransferase Pmt2 [Saccharomyces cerevisiae]
6ZQP_A	1.77e-09	360	438	22	106	Structure of the Pmt2-MIR domain with bound ligands [Saccharomyces cerevisiae]
6ZQQ_A	3.07e-06	360	407	14	63	Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_B Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_C Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_D Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74189|PMT1_CANAL	8.51e-83	63	433	50	416	Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT1 PE=2 SV=1
sp|Q59X23|PMT4_CANAL	4.53e-79	77	433	43	419	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|Q9UKY4|POMT2_HUMAN	6.19e-77	70	439	46	414	Protein O-mannosyl-transferase 2 OS=Homo sapiens OX=9606 GN=POMT2 PE=1 SV=2
sp|P31382|PMT2_YEAST	1.41e-76	81	438	64	425	Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT2 PE=1 SV=2
sp|P33775|PMT1_YEAST	3.81e-73	84	439	52	399	Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000076	0.000001

TMHMM  Annotations     

Start	End
79	98
136	158
165	187
191	213
218	237
252	274
309	331