CAZyme Information: OON06413.1

Basic Information

• Species: Batrachochytrium salamandrivorans
• Lineage: Chytridiomycota; Chytridiomycetes; ; NA; Batrachochytrium; Batrachochytrium salamandrivorans
• CAZyme ID: OON06413.1
• CAZy Family: GT14|GT77
• CAZyme Description: Mannosyl-oligosaccharide glucosidase [Source:UniProtKB/TrEMBL;Acc:A0A1S8VXE8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
899		101324.27	5.2752

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BsalamandrivoransBS	10186	N/A	51	10135

• Gene Location: location=LYON01000579:9075-12723(-)

Full Sequence      

MGFDQFHVSRLLLLVWIAAVAALASIDGNNNIDSNNDVDGNNNNDNDDNNHILEMAVRQA
HNRSLLWGTYRPNLYFGTRSRTPETLLSGLMWFGVSDLQSQPWDNIRHSCEHDESLAGYA
WTKHSGRSYGDQAISDIANNISMRTQFLKTSSGDWSVRISATPLEGADPKDISLLFYAGL
DGRGKLDLVEDTKLTADLERIRDADRSRDDILGNDASNPLASRPSPFMLRGETPLLGKFA
MVFHQEPSSGNIPPPIHPAAVAAATSMRLADLRDPVLIKAKMPGDTIWKIKDHVRSLLVT
NAQKLHEQHAPSGFNRFIPPANMMHLGESSAPGSHGNVAVFQQTFRAPFSIDIVFMSQEG
RSHDGPIVAVDAANFVGPKLSEALVAAESEFDSRFEATFHLTERGFSESEVSLGKMLLSN
MIGGMGYFHGTSIVDRSLEYVDSDDLVDYLHEEGDNSDDDLINEYYDSAPSSGPALGPQE
EGPTTLFTDVPSRPFFPRGFYWDTGFHQHIIGVWDNALSLDVISHWASLIDENGWVGREQ
ILGDEPRSKVPKEFQTQYSHFANPPTLVTALLRYLDRLKKVRIGRANEESAAYNENTMVD
DPQFLADYQLNIPSASNAYLKAVYPSFKRQYMWFRRTQWGQISEWNRKSTSKEAFRWRGR
KGQHTLTSGLDDYPRSNEPHTGELHVDLLCWMSIYAKTLGSIAEELEIESDVAMFAEHYK
NMLVSLEELHWDEVSQSYTDLSINDRGESYHVVHKGYISLFPLLLGLLEHDSPHLGAILN
LIENKRELWTPYGIASLSQSDAFFGTGENYWRGPIWININYLVLQSLFKNYIGKNGPYQA
QAQRIYNNLRSIIITNVHKEYVRTGYVWEQYSPHDGQGKRSHPFTGWTALVLLIMSEDY

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	677	897	2.6e-25	0.4456140350877193

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	2.20e-180	377	897	3	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	9.63e-65	65	308	1	213	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	7.33e-06	697	845	428	561	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13455.1|GH63	5.85e-242	59	899	36	804
CDU22654.1|GH63	2.27e-209	58	899	65	866
CDR44291.1|GH63	3.13e-208	60	899	35	807
SJX62966.1|GH63	7.15e-208	58	899	65	866
CBQ73129.1|GH63	1.43e-207	58	899	65	866

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MHF_A	2.36e-137	65	899	37	779	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
4J5T_A	2.47e-127	62	897	12	802	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
4WVA_A	8.04e-07	724	897	271	420	Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVA_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVB_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVB_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVC_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8],4WVC_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8]
2Z07_A	3.23e-06	724	897	271	420	Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8 [Thermus thermophilus],2Z07_B Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8 [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	2.96e-190	57	899	34	808	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|Q80UM7|MOGS_MOUSE	4.53e-137	65	899	92	834	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	4.84e-136	67	899	94	834	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	4.11e-129	65	899	94	837	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5
sp|P53008|CWH41_YEAST	2.23e-126	62	897	42	832	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000266	0.999725	CS pos: 28-29. Pr: 0.5153

TMHMM  Annotations     

There is no transmembrane helices in OON06413.1.