CAZyme Information: OON06304.1

Basic Information

• Species: Batrachochytrium salamandrivorans
• Lineage: Chytridiomycota; Chytridiomycetes; ; NA; Batrachochytrium; Batrachochytrium salamandrivorans
• CAZyme ID: OON06304.1
• CAZy Family: GT14
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410		47055.66	8.1189

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BsalamandrivoransBS	10186	N/A	51	10135

• Gene Location: location=LYON01000601:9147-10814(+)

Full Sequence      

MLAWTDMVVTPIPSNSLFFFIAIHVLSLYCTAFHCTVATVAIMVTIRVAMAQFALHLHST
LSLLHLYQLISLPPLPLSILYDDRSAMCSIKSSSYRSVFLVLLFVVGVTLFMLPPNMLRA
PISWVVNCRAPTVYTPGTAATKPTPIPRIIHHSWKTQDLPKKFVIWRDSWRDQHPFWEHK
LWTDSDNLKLCTEDFPWFLDTYNSMAKNINRADAARYMYMYKFGGFYSDLDVECIKNHMP
LARWGGLILPLMSDDYLFDNNIPNAWMGSIPGHPFWLFLLKRISSNELPGRVEAVAGPMA
LREGAVAYSAFHGVVNTFPIHYVEPGIVFPYDWHRPEGVWKICSAQSPKANFTMCKQILD
PKHRAYSITYWSHTWGDGTTNVDKDEVADDSLLYRRKVTSLTSVYREMRE

Enzyme Prediction     

No EC number prediction in OON06304.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	167	240	1e-19	0.8666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	4.32e-30	144	310	80	245	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.99e-17	160	241	1	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BDA50134.1|GT32	9.23e-62	146	375	46	285
UKZ71055.1|GT32	2.53e-54	142	390	91	373
UJR33791.1|GT32	1.60e-44	146	381	74	336
BDA46143.1|GT32	2.66e-44	171	375	2	237
AEO66576.1|GT32	3.61e-43	146	384	98	409

PDB Hits     

OON06304.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	3.23e-27	133	283	44	188	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	4.85e-24	139	287	48	190	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	1.57e-23	143	283	59	193	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	1.17e-22	146	284	64	200	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q9UT67|IMT2_SCHPO	1.33e-20	146	286	82	216	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999004	0.000993

TMHMM  Annotations     

Start	End
20	42
94	113