CAZyme Information: OON06303.1

Basic Information

• Species: Batrachochytrium salamandrivorans
• Lineage: Chytridiomycota; Chytridiomycetes; ; NA; Batrachochytrium; Batrachochytrium salamandrivorans
• CAZyme ID: OON06303.1
• CAZy Family: GT1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363		42086.01	6.9650

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BsalamandrivoransBS	10186	N/A	51	10135

• Gene Location: location=LYON01000601:7115-8645(+)

Full Sequence      

MPQETPYTPFTREGPDHVDNSDSSDINSHSTKYVNKTITYASDMKFQSSHSDTKKSLLKP
PKKGNTSYKKLIVIMIGFLSLLYVVVIVKHALSQCPASIELDDTVTTRVALANNSHPPYV
PIPHIIHQSWKTQILPYKFQAWRDTWINHHKEWEYILWTDSDNIKICKDHFPWMLERFQA
FPKNINRADTARYMYMYLHGGFYADLDMECLKPHTVIAQRGGLVAPLMSRDYSFEHNIPN
AWMGSAPRHPFWIFLLNKIKDRPLDNEIESATGPVVMYHALREFEKDYLDETMPPITYMS
PETILPYDWHNTANLIEICSAQRDTLDPEKCKKAVDPDLKAFAITYWSHTWGDGDGKIST
PFR

Enzyme Prediction     

No EC number prediction in OON06303.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	139	214	8.6e-20	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.18e-25	120	298	80	253	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.11e-15	144	213	9	82	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BDA50134.1|GT32	2.85e-57	122	351	46	285
UKZ71055.1|GT32	3.82e-54	93	350	57	356
ANH56535.1|GT32	1.23e-53	122	350	104	362
QLI72987.1|GT32	3.17e-47	121	350	69	344
UJR33791.1|GT32	1.72e-46	65	363	9	342

PDB Hits     

OON06303.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UT67|IMT2_SCHPO	4.84e-23	122	309	82	265	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P33300|SUR1_YEAST	6.91e-22	101	260	31	187	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	6.99e-22	122	263	57	189	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	2.26e-21	117	286	58	225	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	1.36e-20	122	251	64	191	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

Start	End
71	88