CAZyme Information: OON05970.1

Basic Information

• Species: Batrachochytrium salamandrivorans
• Lineage: Chytridiomycota; Chytridiomycetes; ; NA; Batrachochytrium; Batrachochytrium salamandrivorans
• CAZyme ID: OON05970.1
• CAZy Family: GH76
• CAZyme Description: Glyco_trans_2-like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1S8VUG0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
699	LYON01000666|CGC1	79265.49	7.8650

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BsalamandrivoransBS	10186	N/A	51	10135

• Gene Location: location=LYON01000666:9856-12520(+)

Full Sequence      

MSQRPSDADRPQSPQARPYYQQQPQPPPGFLPGNPRPDGAPILQPQQQQYNSQYYAQQQQ
QYQNYYAQQQQGNYAGPPPPPPQKGPSSGSQAPFRPDMMDASQGQRVAPPPSSQYRPAPY
VAHGYAPYQPTSAPAGAGMQGGNPNNGRSPYQQQPQGYGFAPPQQYRPPGQPPVQQHGQQ
PGRPGYKAPQQGPVDTSANQGLQDWDDAASESTGTFYEDTPENRAGPAAAPGANQGGSNS
APGQGASSGTPNIPTRSYALVEDEGVRTNLGNTKFVMAVLSEWWIFSLIFIIGGTYLFHF
KLPQDYVDNEIWNYTCFWKIGWILPFPYTLICFFGLVLPYRTPKFLYSDALPKRRIDNFY
ILTVTKGDNREAVYRSWNAHKHLERLHPCVRVHVLTDEPYFFENVNCYTCPKLFTTAGSK
YKARALEWYRQTMRFTEHDWVLHLDEESVIDDESIKAALEFVWYEHDYHWGQGLILYNQY
KFWSNWFFTGADAIRVGDDLSRFALQYSYFHAPIFGAHGSFLLNNGAVENAITWDLGSLT
EDYQFATHAHEKGFRCSKVPGIVREQSPIDFIGFLKQRRRWFVGIRRLPYILPKVWAFFW
AIGTLSLFCTLSALVLGFVIHKGTPRWFGFLKDFSFITFTYLYQIGIIVQNVDKKINPIL
IILCIPLTFLLQYAACVMEALAVIYGLISPPSDFDVIKK

Enzyme Prediction     

No EC number prediction in OON05970.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	440	634	3.1e-23	0.9187817258883249

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	3.76e-23	440	616	1	173	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	1.50e-09	311	671	11	390	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
236669	PRK10263	2.79e-06	89	191	739	843	DNA translocase FtsK; Provisional
367362	Glutenin_hmw	3.33e-06	86	257	535	706	High molecular weight glutenin subunit. Members of this family include high molecular weight subunits of glutenin. This group of gluten proteins is thought to be largely responsible for the elastic properties of gluten, and hence, doughs. Indeed, glutenin high molecular weight subunits are classified as elastomeric proteins, because the glutenin network can withstand significant deformations without breaking, and return to the original conformation when the stress is removed. Elastomeric proteins differ considerably in amino acid sequence, but they are all polymers whose subunits consist of elastomeric domains, composed of repeated motifs, and non-elastic domains that mediate cross-linking between the subunits. The elastomeric domain motifs are all rich in glycine residues in addition to other hydrophobic residues. High molecular weight glutenin subunits have an extensive central elastomeric domain, flanked by two terminal non-elastic domains that form disulphide cross-links. The central elastomeric domain is characterized by the following three repeated motifs: PGQGQQ, GYYPTS[P/L]QQ, GQQ. It possesses overlapping beta-turns within and between the repeated motifs, and assumes a regular helical secondary structure with a diameter of approx. 1.9 nm and a pitch of approx. 1.5 nm.
367362	Glutenin_hmw	4.80e-05	83	256	374	549	High molecular weight glutenin subunit. Members of this family include high molecular weight subunits of glutenin. This group of gluten proteins is thought to be largely responsible for the elastic properties of gluten, and hence, doughs. Indeed, glutenin high molecular weight subunits are classified as elastomeric proteins, because the glutenin network can withstand significant deformations without breaking, and return to the original conformation when the stress is removed. Elastomeric proteins differ considerably in amino acid sequence, but they are all polymers whose subunits consist of elastomeric domains, composed of repeated motifs, and non-elastic domains that mediate cross-linking between the subunits. The elastomeric domain motifs are all rich in glycine residues in addition to other hydrophobic residues. High molecular weight glutenin subunits have an extensive central elastomeric domain, flanked by two terminal non-elastic domains that form disulphide cross-links. The central elastomeric domain is characterized by the following three repeated motifs: PGQGQQ, GYYPTS[P/L]QQ, GQQ. It possesses overlapping beta-turns within and between the repeated motifs, and assumes a regular helical secondary structure with a diameter of approx. 1.9 nm and a pitch of approx. 1.5 nm.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR39189.1|GT2	5.46e-94	273	699	797	1229
SAM81576.1|GT2	9.76e-85	273	699	629	1070
CDI53092.1|GT2	2.34e-83	273	699	626	1067
CBQ72522.1|GT2	2.09e-81	273	699	627	1068
SJX62383.1|GT2	2.09e-81	273	699	627	1068

PDB Hits     

OON05970.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O01346|EGH_DROME	8.74e-30	323	699	60	449	Beta-1,4-mannosyltransferase egh OS=Drosophila melanogaster OX=7227 GN=egh PE=2 SV=1
sp|Q03562|BRE3_CAEEL	1.55e-24	415	699	157	450	Beta-1,4-mannosyltransferase bre-3 OS=Caenorhabditis elegans OX=6239 GN=bre-3 PE=2 SV=2
sp|A8XAC4|BRE3_CAEBR	2.79e-24	415	699	157	450	Beta-1,4-mannosyltransferase bre-3 OS=Caenorhabditis briggsae OX=6238 GN=bre-3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

Start	End
276	298
318	340
595	617
627	649
656	678