CAZyme Information: OON04925.1

Basic Information

• Species: Batrachochytrium salamandrivorans
• Lineage: Chytridiomycota; Chytridiomycetes; ; NA; Batrachochytrium; Batrachochytrium salamandrivorans
• CAZyme ID: OON04925.1
• CAZy Family: GH47
• CAZyme Description: trehalose-phosphatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1083		121510.57	6.7158

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BsalamandrivoransBS	10186	N/A	51	10135

• Gene Location: location=LYON01000914:2690-7618(-)

Full Sequence      

MNSRTNNNMDGIGGTPPLTDGREDQWPYRRLLVVSLFLPYTPCAAEMPPTIVKMQPHATD
IPQLTRRLSLLSSMTTMATMAAQTVSTASNSSHRLEHSSRNHLHPIDLSKCTVEPSSAGN
IGLQNAINAFSGMASDHLWIGTIGVNTDNASALQLDVLKNRFIREHASRPVFVRQDELDG
HYNQFCKQVLWKPFHYQLPDYPKLRGYEESAWQNYKIVNQKFANAIAEEYREGDIVWVND
YHLMLVPLMVRQLIPTASIAFFLHIPFPSSEIFRCLPARKQILEGLLGADMIGFQTYAFM
RHFLMTCTRLLTLDTTPKGIQLENSVVSLGIYPIGIDLSSFNAKRTHPEVAEIITSLRVK
YNGMHIVIGRDKNDYVKGVRQKLLAFERFLIQYPEWCGRVVLIQVALSTTEANELETHVS
DVVSRINSRFGGIAYVPVVYLQQDISFNHYLALLSIADACLITSLRDGMNLTSHEYVVCQ
ETKHSPLIISEFAGTYGSFGAAIRINPWDGQEVADAIHEALTMTADEKQYRWNMLYQYVS
TNTAQSFAETFVADAARVHSENMTIMSASISRLSFESLCDSYICSRKRLFLLDDEGTLFS
NPLDSAILLHTTEISRAKKLLNDLCKDERNIVYLMSGRRRSDLDSFFEIPLLGICAENGA
FIKYSDRSKWETVLQDQDFSWRKKVLEVFEYYTDRTPGSFIEKKEIGISWYYGLADTGFG
AWQAAECHNHLQNTVTATYPVHIISKKKCVEVMPCNVSKATMTRRILEHHQVRSKHRNPS
YSPYPVPLQSYSPQSVAPRILSPSVASFRLGSFIDHGGVPGESDLFLGSLEPYEATSPSH
VSREIHYRGDPECDQSDHGTINTGGTSFPGTDGISIASIESHSSHCTSPYAQRHSVQASG
SSTHVERIDFVLCIGNDRSDEHMFEYLGRLAARENKSRRTKHTIHDAPFVYNSEPRSDCK
PIGFAFTHVDNDVEPFDGIEGDGMMHEPDTSSRDAHSSPISEPTEGVCSSPLSPDVLQAS
SLPFELTTASAMLSRQKGKRYRKIITCTVGAKSSSAKSYVPNVASVLDGLEYLYLHSHKT
FFT

Enzyme Prediction     

EC	2.4.1.15:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	105	555	1e-161	0.9284210526315789

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	101	556	7	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
184712	PRK14501	0.0	113	771	23	670	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
395781	Glyco_transf_20	0.0	115	557	28	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
223457	OtsA	5.21e-159	117	559	42	481	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
215556	PLN03064	4.96e-158	117	776	120	785	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09009.1|GT20	1.60e-223	107	768	161	826
AMJ52388.1|GT20	7.54e-204	112	767	133	776
EGX50369.1|GT20	1.29e-196	112	768	175	834
AEO53735.1|GT20	3.79e-185	119	766	165	821
VBB71954.1|GT20	2.03e-184	119	766	170	826

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JBI_A	1.04e-114	127	558	31	465	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVM_A	3.53e-114	122	558	41	477	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUV_A	1.41e-107	122	554	33	466	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	7.44e-107	122	554	33	466	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HVO_A	5.64e-106	139	554	56	473	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54K57|TPSA_DICDI	8.01e-150	127	767	47	674	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|O14081|TPSX_SCHPO	1.23e-143	113	733	202	839	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E11.16c PE=1 SV=1
sp|Q54NU9|TPSB_DICDI	5.42e-139	136	768	95	727	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|Q9UUI7|TPSY_SCHPO	2.95e-129	109	769	161	826	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22F8.05 PE=1 SV=1
sp|Q9SYM4|TPS1_ARATH	5.35e-128	139	767	136	775	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Arabidopsis thaliana OX=3702 GN=TPS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.813529	0.186478

TMHMM  Annotations     

There is no transmembrane helices in OON04925.1.