CAZyme Information: OON04622.1

Basic Information

• Species: Batrachochytrium salamandrivorans
• Lineage: Chytridiomycota; Chytridiomycetes; ; NA; Batrachochytrium; Batrachochytrium salamandrivorans
• CAZyme ID: OON04622.1
• CAZy Family: GH35
• CAZyme Description: GPI mannosyltransferase 2 [Source:UniProtKB/TrEMBL;Acc:A0A1S8VQT9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
457		51436.69	8.9860

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BsalamandrivoransBS	10186	N/A	51	10135

• Gene Location: location=LYON01000997:1371-3442(-)

Full Sequence      

MKNKSLNRSFNRTPRTSGAATTDDTPSTWLVVKLVFASRAIYLCIAVASSLLATEYDTSV
TVSNKLSASTIHHTCTGSVSRIALSLMKPLIRWDAVYFLSIAESGYTYEQQFAFFPGLPL
LMRSFAALLRLITGGSMCDQALLAMAGLFVTNMMFVGAAISLYWLSIHILRDNRLAVISA
ALFAFSPAGIFMSSIYTESPFAMCAFAGMLCMVRGRIWYASAWWFCASLIRANGILLAGF
LVWDMLHPFSPQKNLSFGIRAVRNIMAIGIAVIPFVLFQYYSWNLFCTGMDGIQRPWCTN
FIPSLYSFVQDYYWNNGFLKYYTLQQIPNFLLATPYLLVSVMGISEFIYRYRLEVLSLGF
ITSQESERAQLIRTQLPFMYLWMAMLAICALFMHVQVILRFFTSMPMLFWVLAQWLGQCS
SDTTAYRLGMAGSMFSVYYAVYPAVGAVLFACFLPPA

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	31	457	3.4e-110	0.9975429975429976

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	2.96e-61	31	457	4	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	5.36e-18	85	457	66	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09540.1|GT76	5.71e-74	31	457	7	392
BBN03197.1|GT76	1.93e-52	81	455	73	480
QHO38400.1|GT76	2.00e-52	31	367	14	362
QHO07244.1|GT76	2.04e-52	31	367	14	362
CCH50968.1|GT76	6.91e-51	31	367	16	362

PDB Hits     

OON04622.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5KR61|PIGV_RAT	4.46e-48	77	410	50	415	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1
sp|Q9NUD9|PIGV_HUMAN	4.55e-48	77	410	50	415	GPI mannosyltransferase 2 OS=Homo sapiens OX=9606 GN=PIGV PE=1 SV=1
sp|Q7TPN3|PIGV_MOUSE	6.30e-47	77	410	50	415	GPI mannosyltransferase 2 OS=Mus musculus OX=10090 GN=Pigv PE=2 SV=2
sp|Q4I0K3|GPI18_GIBZE	1.18e-43	85	457	57	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	6.84e-39	36	457	26	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.993720	0.006289

TMHMM  Annotations     

Start	End
112	134
144	166
175	197
221	243
264	283
322	344
378	400
432	454