CAZyme Information: OON04470.1

Basic Information

• Species: Batrachochytrium salamandrivorans
• Lineage: Chytridiomycota; Chytridiomycetes; ; NA; Batrachochytrium; Batrachochytrium salamandrivorans
• CAZyme ID: OON04470.1
• CAZy Family: GH31
• CAZyme Description: Protein xylosyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A1S8VQ69]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
930		106301.09	7.3882

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BsalamandrivoransBS	10186	N/A	51	10135

• Gene Location: location=LYON01001039:4830-8076(-)

Full Sequence      

MSLPLKVQLWVQQNLAGRSRLLRTVTILIVSMAVVIWALSAILGGMMKQQQPSSHSLPLD
SPHQQDLSWQHQERVQPQSPPVTEHKQPPSSIKPLYPSPVQPSIDKDFVVVAGDRFYTPK
AMPVLKTALDGRIFNASGFTFCDILNGARFDATVHIDVLGGSVAQVNPDRYTFVDAVDAK
AHDIFQSVLYQSEFGDRKVKPNREELRRLSCYFSAEGNSAYANFTQTRLLVEVEPLNYFR
DRLKAIVPHPSLIPGPRRKYLIAYLLMVHEENGFPHLRKLLETLDDGDAIILIHVDNRPK
SNNLKVKIEDFIGQRERLLGSPTNVFLSKYRFSNIWGHSSLVFTQLSGFWELLDMADWDY
VINLSNYDFPLRRNVDIHRILNKPNNRGKNFIEYWPDTEDLAERFYRAHIGDADFSSLFH
PNGLGVTSWPFPRWRAYKHHQWMIVSPDFIRFLRSDSDALNFLAFSEHIYIPDESYFATV
LVNSPQFSDTVVNDNKRYLRFAGGGAAHPSWLGYKDRFLFPAGEPEPSFFFIRKMNVFGT
SFEEGRLLEWIDTHHMHSSFSIDGNEAQDNQPCKIEDASVRIACLKEFGDKFSVNNELVI
VAVNRAFLVHAANLRCSLVHSGINNLVYWSLDIEVHESLISKGRLSIFLAGFPSTSERQD
PSKPYFVKMMRYKPKVLAMFLEAGFNVWYMDADSVSLQDFRPEIVADESVHVHVALGNEK
RIDINLAGEDADVPLASAGIMYLRNHPSSKLFIQHVLDMQTQSMLLSDQDAMRKVIANRD
LVVTSFTTSQTAIKRRGLVRRSDYDVHKRSDDVYNPSNVDRTSLHIAEKTNGKFPRGMDS
HPAKIHIRYFDQFQFINGIILFDHTTEIPMNFDQFKVVHSRPLENPAATLSKWGLWFLDS
KGTCANKDSSLLDARMKLLEQASVQGNWVR

Enzyme Prediction     

No EC number prediction in OON04470.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT14	262	510	2.4e-42	0.964

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396855	Branch	3.99e-19	262	516	1	240	Core-2/I-Branching enzyme. This is a family of two different beta-1,6-N-acetylglucosaminyltransferase enzymes, I-branching enzyme and core-2 branching enzyme. I-branching enzyme is responsible for the production of the blood group I-antigen during embryonic development. Core-2 branching enzyme forms crucial side-chain branches in O-glycans. This is a fmmily of glycosyl-transferases that are Type II membrane proteins that are found in the endoplasmic reticulum (ER) and Golgi apparatus.
367480	Nucleotid_trans	1.29e-11	622	772	2	148	Nucleotide-diphospho-sugar transferase. Proteins in this family have been been predicted to be nucleotide-diphospho-sugar transferases.
178725	PLN03183	9.09e-09	356	516	172	335	acetylglucosaminyltransferase family protein; Provisional
234938	PRK01297	0.003	35	142	1	110	ATP-dependent RNA helicase RhlB; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UOU96877.1|GT14	5.81e-22	256	593	18	317
AOG05113.1|GT14	6.08e-22	261	505	1	230
QIY87205.1|GT14	6.79e-21	261	497	1	223
VEG97549.1|GT14	1.68e-20	261	497	1	223
UKB81230.1|GT14	3.87e-20	256	497	18	244

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EJ7_A	1.73e-14	256	497	114	343	Human Xylosyltransferase 1 in complex with UDP-xylose and peptide QEEEGAGGGQGG [Homo sapiens],6EJ9_A Human Xylosyltransferase 1 in complex with peptide QEPEGSGGGQGG [Homo sapiens],6EJA_A Human Xylosyltransferase 1 in complex with peptide QEEEYSGGGQGG [Homo sapiens],6EJB_A Human Xylosyltransferase 1 in complex with peptide QEEEGSAGGQGG [Homo sapiens],6EJC_A Human Xylosyltransferase 1 in complex with peptide QEEEGSGVGQGG [Homo sapiens],6EJD_A Human Xylosyltransferase 1 in complex with peptide QEEEGSGGPQGG [Homo sapiens],6EJE_A Human Xylosyltransferase 1 in complex with peptide PAAEGSGEQDFT [Homo sapiens],6FOA_A Human Xylosyltransferase 1 apo structure [Homo sapiens]
6EJ8_A	1.74e-14	256	497	118	347	Human Xylosyltransferase 1 in complex with peptide QEEEGSGGGQGG [Homo sapiens]
3OTK_A	1.68e-10	262	559	86	363	Structure and mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus],3OTK_B Structure and mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus],3OTK_C Structure and mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus],3OTK_D Structure and mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus]
2GAK_A	6.91e-10	262	559	86	363	X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) [Mus musculus],2GAK_B X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) [Mus musculus],2GAM_A X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) in complex with Galb1,3GalNAc [Mus musculus],2GAM_B X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) in complex with Galb1,3GalNAc [Mus musculus],2GAM_C X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) in complex with Galb1,3GalNAc [Mus musculus],2GAM_D X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) in complex with Galb1,3GalNAc [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9EPI1|XYLT1_RAT	1.18e-15	254	497	188	416	Xylosyltransferase 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Xylt1 PE=2 SV=1
sp|Q5QQ56|XYLT1_CANLF	3.47e-14	262	497	317	540	Xylosyltransferase 1 OS=Canis lupus familiaris OX=9615 GN=XYLT1 PE=2 SV=1
sp|Q5QQ57|XYLT1_PANTR	1.03e-13	256	497	308	537	Xylosyltransferase 1 OS=Pan troglodytes OX=9598 GN=XYLT1 PE=2 SV=1
sp|Q86Y38|XYLT1_HUMAN	1.04e-13	256	497	322	551	Xylosyltransferase 1 OS=Homo sapiens OX=9606 GN=XYLT1 PE=1 SV=1
sp|Q811B1|XYLT1_MOUSE	1.04e-13	256	497	316	545	Xylosyltransferase 1 OS=Mus musculus OX=10090 GN=Xylt1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000013

TMHMM  Annotations     

Start	End
21	43