CAZyme Information: OON04439.1

Basic Information

• Species: Batrachochytrium salamandrivorans
• Lineage: Chytridiomycota; Chytridiomycetes; ; NA; Batrachochytrium; Batrachochytrium salamandrivorans
• CAZyme ID: OON04439.1
• CAZy Family: GH31
• CAZyme Description: GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A1S8VR22]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505	LYON01001047|CGC1	56123.94	7.8076

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BsalamandrivoransBS	10186	N/A	51	10135

• Gene Location: location=LYON01001047:1430-3824(-)

Full Sequence      

MAQWPHSVWTLQTTVAIVLVSFVIAISVAVCTAAWALWPLPKQVQRSRLRPAVHHSDPSL
TTSTRPLSVVGFFHPYCDAGGGGERVLWTAIDSLLKGLLKERVLDTLFVIYTCPLAGSTN
QILVKVKAQFGIEVPPEAIRFAPLESWMYLEAKRYKRLTLLLQSLGSMITGWEAMQQIIP
DVFVDTIGFAFIYPIAKFFGAKVIPYVHYPTISSDMIQKVQDRESNFNNSNDISNSVVLS
NLKLAYYQAFSVLYGYVGSYADAVMVNSSWTLGHINKIWNIPLRTAIVFPPCDTTSLSKF
SLHGRERVIISVAQFRPEKNHGLQIDAFSLLLQNHPQLRHGTASSVQLLIVGSVRNDEDA
MRVCMLREQIDRLDLKDSVKILENVSYGELQSLLSKSLIGLHTMWNEHFGISIIEYMAAG
VIPIASNSGGPMMDIVVSFSKKTTGFLASTEQEYADAIYNVLSLPTAAQLAIQEASRESV
LHRFSASKFSLDFVATIEKQLSSIS

Enzyme Prediction     

EC	2.4.1.131:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	304	466	1.1e-30	0.9125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340835	GT4_ALG11-like	0.0	69	492	2	419	alpha-1,2-mannosyltransferase ALG11 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ALG11 in yeast is involved in adding the final 1,2-linked Man to the Man5GlcNAc2-PP-Dol synthesized on the cytosolic face of the ER. The deletion analysis of ALG11 was shown to block the early steps of core biosynthesis that takes place on the cytoplasmic face of the ER and lead to a defect in the assembly of lipid-linked oligosaccharides.
215511	PLN02949	6.31e-165	69	505	35	462	transferase, transferring glycosyl groups
406369	ALG11_N	9.76e-110	69	279	2	208	ALG11 mannosyltransferase N-terminus.
395425	Glycos_transf_1	1.47e-26	306	465	2	145	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
340831	GT4_PimA-like	4.34e-25	254	498	134	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIT18233.1|GT4	7.46e-128	58	497	47	477
AFP02143.1|GT4	6.77e-126	69	498	62	485
CDS14033.1|GT4	2.23e-125	44	501	29	475
AHH38109.1|GT4	1.93e-121	70	498	63	492
BBM97969.1|GT4	4.39e-121	69	498	36	457

PDB Hits     

OON04439.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q3TZM9|ALG11_MOUSE	3.02e-121	37	501	39	491	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg11 PE=2 SV=1
sp|Q08B22|ALG11_XENLA	2.82e-120	69	498	60	482	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Xenopus laevis OX=8355 GN=alg11 PE=2 SV=2
sp|Q6P312|ALG11_XENTR	6.54e-119	69	498	62	483	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Xenopus tropicalis OX=8364 GN=alg11 PE=2 SV=1
sp|Q7ZW24|ALG11_DANRE	3.90e-118	70	504	63	498	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Danio rerio OX=7955 GN=alg11 PE=2 SV=2
sp|Q2TAA5|ALG11_HUMAN	1.93e-116	69	499	64	489	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG11 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

Start	End
16	38