CAZyme Information: OON04314.1

Basic Information

• Species: Batrachochytrium salamandrivorans
• Lineage: Chytridiomycota; Chytridiomycetes; ; NA; Batrachochytrium; Batrachochytrium salamandrivorans
• CAZyme ID: OON04314.1
• CAZy Family: GH30
• CAZyme Description: trehalose-phosphatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
579		65285.74	7.3517

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BsalamandrivoransBS	10186	N/A	51	10135

• Gene Location: location=LYON01001082:5848-8809(-)

Full Sequence      

MLGANLIGFQTYSHARHFNSSCTRVLGCESSPTGVEFQGFTTSIGIFPIGIDVERVKGLC
AKESVQQKAKLIRELFPGKKIIMGRDNLDHIKGILHKLQSFEKFLQMFPEWHNKVALIQV
TSPPHRPSASFSTKVSETISRINGTFGSLEYVPVHHYHQLLDEDEYYALLSIADVSLITS
LRDGMNTSSHEFVVCQKEHKGTLILSEFTGSAGSMSGAYLVNPWDHLGVANSINDALMVS
MDDRIIKHKQLYDYVTSHTARFWAMRFIKELRDTLLVTAQQTPTPLMDDIRIVSRYKQSK
KRLLMFDYDGTLTPIHKVPNAAVPPTDMLEFMKILVSDPRNMVFVISGRDQACLDNWLGH
IAGLGLSAEHGSFIKYPGGKWINLAEDIDLSWKTQVAEIFNFFTERTQGSFVEHKRYAIT
WHYRLTDPEYGAFQAKECHTHLENAILSKLPVEILLGKKNLEVRPILTNKGEIVKRLMNQ
QGQQGQQGQQGQQPSAFDFVYCVGDDRTDEDMFRVLRKSDLPETSYFTCTIGPSTKKTHA
QWHMLIPQDVINLIGKLATISTQDADMGSNVATHVSTSL

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	1	272	1.5e-99	0.5789473684210527

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	9.96e-171	1	560	187	726	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
215556	PLN03064	2.82e-141	2	540	286	830	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
215555	PLN03063	4.33e-139	1	571	201	797	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
340820	GT20_TPS	6.34e-129	1	272	188	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	4.90e-119	1	273	192	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13004.1|GT20	9.56e-228	1	561	231	779
CDS06611.1|GT20	9.86e-222	1	559	327	873
AJH76892.1|GT20	3.28e-210	2	558	268	830
EGX46320.1|GT20	5.68e-200	1	554	294	838
QSS49079.1|GT20	3.06e-199	1	557	34	590

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXN_A	1.66e-98	284	557	3	269	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 2 [Aspergillus fumigatus Af293],5DXO_A Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293],5DXO_B Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293]
5DXL_A	1.63e-95	284	557	3	269	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 1 [Aspergillus fumigatus Af293]
5DXF_A	4.75e-81	1	278	251	530	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5DX9_A	5.11e-75	284	557	3	301	Chain A, trehalose-6-phosphate phosphatase [Cryptococcus neoformans]
5DXI_A	3.88e-73	284	558	5	298	Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314],5DXI_B Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78875|TPP1_SCHPO	8.76e-154	1	561	264	816	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|Q54K57|TPSA_DICDI	5.02e-137	1	554	199	731	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q54NU9|TPSB_DICDI	9.81e-132	1	558	240	788	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|O14145|TPS2_SCHPO	4.88e-130	1	557	271	849	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps2 PE=3 SV=1
sp|P31688|TPS2_YEAST	5.56e-130	1	557	252	846	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000001

TMHMM  Annotations     

There is no transmembrane helices in OON04314.1.