CAZyme Information: OON03597.1

Basic Information

• Species: Batrachochytrium salamandrivorans
• Lineage: Chytridiomycota; Chytridiomycetes; ; NA; Batrachochytrium; Batrachochytrium salamandrivorans
• CAZyme ID: OON03597.1
• CAZy Family: GH18
• CAZyme Description: Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A1S8VNA2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
261		29821.06	7.8080

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BsalamandrivoransBS	10186	N/A	51	10135

• Gene Location: location=LYON01001301:6309-7214(-)

Full Sequence      

MNVLLFAPGMAWVFFFNAGLVRSAMNAGLVLVIQVILAAPFLYSAPKSYLTCAFDFSRQF
LHRWTVNWRFVPEDLFSSSEFAMGLLALHILALVLFATTVWRRHIPRHYHCPRQHLKFLD
FITKLVEDLKDGVGVKHIRIEDMPDDVVSPDDTILILFSSNLIGIMCARSLHYQFYSWYC
FTLPYLLWRSGIDVRAKLALFFLIEWAWNVYPSTNVSSGALLLCHLIIVASLVVGHPVHD
ALKPKAAVVVDQDTVEKNKHE

Enzyme Prediction     

EC	2.4.1.258:18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	1	218	9.7e-69	0.554945054945055

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	6.97e-92	1	218	161	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA69403.1|GT58	1.08e-54	1	237	182	405
QRW13371.1|GT58	7.05e-50	1	235	199	413
ACN10443.1|GT58	9.68e-50	1	237	205	421
AAI64529.1|GT58	7.71e-49	1	232	203	414
AAH95802.1|GT58	7.71e-49	1	232	203	414

PDB Hits     

OON03597.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8K2A8|ALG3_MOUSE	3.91e-44	1	232	209	420	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg3 PE=1 SV=2
sp|Q92685|ALG3_HUMAN	1.07e-43	1	235	209	423	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG3 PE=1 SV=1
sp|Q2U6A4|ALG3_ASPOR	7.02e-43	1	219	182	378	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alg3 PE=3 SV=1
sp|O82244|ALG3_ARATH	1.57e-42	1	232	196	415	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Arabidopsis thaliana OX=3702 GN=ALG3 PE=1 SV=1
sp|Q55F69|ALG3_DICDI	1.81e-42	1	232	214	421	Probable Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999903	0.000128

TMHMM  Annotations     

Start	End
4	21
28	45
79	101
175	192
216	238