CAZyme Information: OON03548.1

Basic Information

• Species: Batrachochytrium salamandrivorans
• Lineage: Chytridiomycota; Chytridiomycetes; ; NA; Batrachochytrium; Batrachochytrium salamandrivorans
• CAZyme ID: OON03548.1
• CAZy Family: GH18
• CAZyme Description: Glyco_trans_2-like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1S8VMC1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486		56350.31	7.7018

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BsalamandrivoransBS	10186	N/A	51	10135

• Gene Location: location=LYON01001316:3083-4543(-)

Full Sequence      

MTPPRLSNDSSVGGGTLHDQAPGDIAPRLREQDVEKQEGAQKHSYGSTTDPAPRTNVGNT
KVVMAVLSEMWLLHIIVILCCTYLMTFRLPQFYVDDQLWNNGCYWKLGWIMPLPYTLICF
FGLALPFRTNKFLLRDPTTARRVDNLYILTVTKGDNKDAVMRSWNAHKHLEALDPCVRVH
VLTDEPHFVENINCFTCPKSFQTQNSKYKARALEWYRQTMKYTEHDWILHLDEESIIDDE
SVLRIIDFVHHEHNYHWGQGVILYNQYRYWHNWFFTVADAIRVADDLARFQLQYTYFHRP
VFGAHGSFLLMNGAVENAVTWDLGSLTEDYQFATKAWELGYKCGKIPALVREQSPMDLIG
FLKQRRRWYVGIRRLPMLLPKIWAGFWTLGILALYGTIASVFLGIWVPLGTPRWFGLLKD
FSFVTFVYLYLLGIFVQELDRKTNPFLILLRLIATAVLQFAACVMEAMAVMYGIAFPPSD
FDVIKK

Enzyme Prediction     

No EC number prediction in OON03548.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	227	435	1.9e-29	0.9898477157360406

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	7.78e-26	227	410	1	189	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	2.20e-07	202	439	118	365	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
404520	Glyco_tranf_2_3	2.82e-05	225	369	88	228	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
133043	CESA_CelA_like	0.002	321	371	178	229	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
133049	CESA_like_2	0.002	321	371	179	229	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR39189.1|GT2	2.30e-96	40	486	777	1229
SAM81576.1|GT2	6.01e-91	41	486	610	1070
CDI53092.1|GT2	1.11e-90	43	486	609	1067
CDU25853.1|GT2	2.17e-90	41	486	608	1068
CBQ72522.1|GT2	4.18e-90	41	486	608	1068

PDB Hits     

OON03548.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O01346|EGH_DROME	1.64e-30	110	486	60	449	Beta-1,4-mannosyltransferase egh OS=Drosophila melanogaster OX=7227 GN=egh PE=2 SV=1
sp|A8XAC4|BRE3_CAEBR	3.62e-27	198	486	152	450	Beta-1,4-mannosyltransferase bre-3 OS=Caenorhabditis briggsae OX=6238 GN=bre-3 PE=3 SV=1
sp|Q03562|BRE3_CAEEL	1.67e-26	198	486	152	450	Beta-1,4-mannosyltransferase bre-3 OS=Caenorhabditis elegans OX=6239 GN=bre-3 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000085	0.000001

TMHMM  Annotations     

Start	End
65	87
107	129
382	404
414	436
448	470