CAZyme Information: OON02278.1

Basic Information

• Species: Batrachochytrium salamandrivorans
• Lineage: Chytridiomycota; Chytridiomycetes; ; NA; Batrachochytrium; Batrachochytrium salamandrivorans
• CAZyme ID: OON02278.1
• CAZy Family: CE4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
785		89813.93	8.1808

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BsalamandrivoransBS	10186	N/A	51	10135

• Gene Location: location=LYON01001840:1344-4293(-)

Full Sequence      

MRTGYGSRQWFCLMLLLVLTAALTLWLLWVNRLRDSSIVAEHKIFDFRALSIKSNTNPKV
SKDAATRALSVVPVSPKASIASVLETLPAGLQSPAHFSVKDTSLYRQGDDAANSKDTEVI
LPIDGYYYDKYVRIKKWPRKKGVYFLIVATMIRNKARYVPEWIEFHLLQGFDRFVIYDDR
STDGLREILDPYIKMDVVEYLLWPEDADKVNRSATGPRVFDTPGQEEAFNTHFYKLCIDR
PGNGNQHAHGGCQKAAALDALARYRHKTVWILHSDIDEFFYTPRDSAQTGLSGIVTVRDI
LAQNYHYYDQIIVQGHIFGTNGFMSDPTPVTESMPFPMVMEAYRHRRSHLGNRNQEKQIQ
NRIHAEKAFVKANLPTSTLVHMWTFESPIQPRTMSDMDAVMTLNHYQYRSVFGQNRKAEE
NNNFNIEYSRPADQFLNEVADYSIGYLVPLVRHNLQQRINDKLFIKLPSTDFWKPSRKPF
DKSAKVDICIAITHRSGQVPQLRKTIHTFIHFLNTVDVKVTYKVVFVTQFRGSVGDATQQ
EHTQFKDFYDLVDESKYLDGSATLAEMMDAATDLCGTHAEFILYLEDVWETRFRVPGKRD
SAAHIVDQPVIHEAMELMRDDSSILEVWLGDTPRHPSYTQSRTSWTLTPAALRAMDAVDA
PSDAVSLRRWYRKQTGTPQYQYGVTRLGGTLRHRKRQESVGKWASFDQRSAHTALSLQTL
FGEAAMAKGFASAHICYDKDPEKNPECNLNPDGLNDGSTTGIMWRQRLLLNADAKSTELH
DRPLL

Enzyme Prediction     

No EC number prediction in OON02278.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT92	154	418	1e-16	0.7526881720430108

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396317	Glyco_transf_92	1.16e-12	148	408	7	212	Glycosyltransferase family 92. Members of this family act as galactosyltransferases, belonging to glycosyltransferase family 92. The aligned region contains several conserved cysteine residues and several charged residues that may be catalytic residues. This is supported by the inclusion of this family in the GT-A glycosyl transferase superfamily.
404573	Glyco_tranf_2_4	3.19e-08	153	288	1	92	Glycosyl transferase family 2. Members of this family of prokaryotic proteins include putative glucosyltransferases,

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOK50335.1|GT0	9.88e-15	119	204	15	101
ATZ00393.1|GT0	9.88e-15	119	204	15	101
ATY86768.1|GT0	9.88e-15	119	204	15	101
AII11637.1|GT0	1.04e-14	119	204	19	105
ABX75687.1|GT0	1.04e-14	119	204	19	105

PDB Hits     

OON02278.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B9S2H4|Y232_RICCO	1.02e-08	141	328	292	437	Glycosyltransferase family 92 protein RCOM_0530710 OS=Ricinus communis OX=3988 GN=RCOM_0699480 PE=3 SV=1
sp|Q94K98|Y1720_ARATH	5.34e-08	134	409	280	494	Glycosyltransferase family 92 protein At1g27200 OS=Arabidopsis thaliana OX=3702 GN=At1g27200 PE=2 SV=2
sp|Q6YRM6|Y8219_ORYSJ	2.14e-07	135	204	307	375	Glycosyltransferase family 92 protein Os08g0121900 OS=Oryza sativa subsp. japonica OX=39947 GN=Os08g0121900 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000030	0.000006

TMHMM  Annotations     

Start	End
13	30