CAZyme Information: OON02075.1

Basic Information

• Species: Batrachochytrium salamandrivorans
• Lineage: Chytridiomycota; Chytridiomycetes; ; NA; Batrachochytrium; Batrachochytrium salamandrivorans
• CAZyme ID: OON02075.1
• CAZy Family: CE4
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1S8VI70]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363		39640.08	5.6483

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BsalamandrivoransBS	10186	N/A	51	10135

• Gene Location: location=LYON01001938:427-1907(+)

Full Sequence      

MLATTATIIALMCLTTASASEQVIPGSLLTPIPPNFALGDCVTGRMTFTKDTVTDIAGAE
ARRFSVDRTKYNFTLDYGTADFGEGSMASLALVRNSQDNPMAVAFSSRISTTRYMQYGRI
TIRFKPAAIPGVVTTFITFSDIQKMAPLAGELTQDEIDWEIVGKDTAHPQTNLFTYKALD
LERGMHGGPISAAISTDTPHDYTIDWKSDRIVWSIDNIVMRTLMKSDSRAMNPAALPLNE
SWFPVSPSRVQISVWDGSLTHRSWAGGPINWPPGDVVKVPFEWMDIQCYDNSDRPVERWA
ADGSKRATSEVPIVVPGLSGSRRMGQTENNGNHTSASVGGNWIISHSTTLLMGCLVVLLQ
LGL

Enzyme Prediction     

No EC number prediction in OON02075.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	107	269	2.3e-37	0.8563218390804598

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	9.17e-44	64	290	3	203	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	2.31e-32	105	271	21	166	Glycosyl hydrolases family 16.
185684	GH16_lichenase	2.71e-17	109	266	60	193	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185683	Glyco_hydrolase_16	1.35e-15	106	268	55	194	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185685	GH16_XET	1.96e-12	82	271	22	186	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR92726.2|CBM18|GH16_19	1.22e-28	66	314	83	329
AUB22189.1|CBM18|GH16_19	1.22e-28	66	314	83	329
UOH79555.1|CBM18|GH16_19	1.22e-28	66	314	83	329
CAR28493.1|CBM18|GH16_19	3.94e-28	78	290	95	302
CAR21933.1|CBM18|GH16_19	7.64e-28	67	290	100	306

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	1.45e-17	109	274	62	210	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
3O5S_A	5.29e-10	86	266	64	218	Crystal Structure of the endo-beta-1,3-1,4 glucanase from Bacillus subtilis (strain 168) [Bacillus subtilis]
1GBG_A	3.25e-09	86	266	40	194	Bacillus Licheniformis Beta-Glucanase [Bacillus licheniformis]
5SV8_A	4.06e-09	110	266	49	183	Crystal Structure of the catalytic nucleophile and surface cysteine mutant of VvEG16 in complex with a xyloglucan oligosaccharide [Vitis vinifera]
1CPN_A	5.49e-09	111	284	8	151	NATIVE-LIKE IN VIVO FOLDING OF A CIRCULARLY PERMUTED JELLYROLL PROTEIN SHOWN BY CRYSTAL STRUCTURE ANALYSIS [Paenibacillus macerans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WI46|CRF2_ASPFU	2.78e-25	109	290	128	302	Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf2 PE=1 SV=1
sp|P32623|CRH2_YEAST	1.91e-23	50	290	81	302	Probable glycosidase CRH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTR2 PE=1 SV=3
sp|Q5AJC0|UTR2_CANAL	1.95e-23	109	287	132	296	Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UTR2 PE=1 SV=1
sp|Q05790|CRR1_YEAST	6.21e-19	107	307	179	372	Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRR1 PE=2 SV=1
sp|Q75A41|CRR1_ASHGO	2.13e-16	107	311	187	389	Probable glycosidase CRR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=CRR1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000298	0.999685	CS pos: 19-20. Pr: 0.9775

TMHMM  Annotations     

There is no transmembrane helices in OON02075.1.