CAZyme Information: OON00848.1

Basic Information

• Species: Batrachochytrium salamandrivorans
• Lineage: Chytridiomycota; Chytridiomycetes; ; NA; Batrachochytrium; Batrachochytrium salamandrivorans
• CAZyme ID: OON00848.1
• CAZy Family: CE4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378		43129.32	6.8945

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BsalamandrivoransBS	10186	N/A	51	10135

• Gene Location: location=LYON01002735:311-1860(-)

Full Sequence      

MSTLAESAAPGAPDHHDNNATEATTSTSTLATIYSWCTKVFTGRNPSIPNTPPEKNAFMT
FMTLMLVSRGKTTISLLLVLLVLLYFVVFMYSSDSINPLLSTDHKLSTASTSALGSCSWQ
PKSIAKLVDTPYVRIPHIIHQSWKTNVLPLKFKKWQSSWIEHHPDWTYTLWTDDDNMRIC
KEHFPWMLERFNSFSKNINRADTARYMYMYMIGGFYADLDVDCLKPHTPIANKGGIVLPL
MSRDYTFEHNIPNSWLGSVPGHPFWIFLLNKIKDRPLDQNIEASTGPIVLYHALREFELN
HMDESMPTITYMPKELVIPYDWHNTEGLLDICSATKSTINTTRCRELVDPFNKAFTITYW
SHSWGDGDGQISKPFSSP

Enzyme Prediction     

No EC number prediction in OON00848.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	152	232	1.4e-19	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.31e-27	135	310	82	256	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	8.36e-15	149	230	1	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ71055.1|GT32	2.77e-59	98	363	60	356
BDA50134.1|GT32	1.11e-57	135	364	46	285
ANH56535.1|GT32	5.54e-52	124	363	93	362
AEO66576.1|GT32	1.30e-49	123	366	82	399
QLI72987.1|GT32	1.50e-49	135	363	70	344

PDB Hits     

OON00848.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	4.98e-27	129	298	56	224	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	6.98e-27	135	290	57	211	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	1.88e-26	134	327	63	266	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q9UT67|IMT2_SCHPO	2.55e-24	101	288	60	234	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P33300|SUR1_YEAST	3.07e-24	135	290	55	209	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999910	0.000112

TMHMM  Annotations     

Start	End
72	91