CAZyme Information: OON00529.1

Basic Information

• Species: Batrachochytrium salamandrivorans
• Lineage: Chytridiomycota; Chytridiomycetes; ; NA; Batrachochytrium; Batrachochytrium salamandrivorans
• CAZyme ID: OON00529.1
• CAZy Family: AA2
• CAZyme Description: Alginate_lyase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1S8VEB5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480		52979.34	6.6973

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BsalamandrivoransBS	10186	N/A	51	10135

• Gene Location: location=LYON01003020:247-1852(+)

Full Sequence      

MAVLFSLLLHTLALLLEQASAATWPLTDAGLPAPGSIQTFYMSSRNLWLNRQLWQEGHTE
LRPSIRRILRLADGAVMDTKSYSVSSKNSSLSAPSNDPHDYYSLSPFYWPTAANVQATDP
IPGGPYARFDGYTNPEVYLYQDPQYMQLMLDDVLHCSLAYFFTGNETYAATATRRLSSWF
VDPVTAMKPSMEYAASVRGVDVTQASPTIDLATSNGTKTADATGVLMDMNKIYLLIDSVG
LIRGSSSFTPDHYKGIQTWIQSYQTWSMTHHRAKTFGASVNYQGSWFDVQQVSMLLFLNK
TTEAAAVITQSSLSRMALQIASKDGSQPLELARPLSWFSATYNLEALFVLGFLAHSASVD
LFKFVDATTGEQTIASALKYMIPFAQTNGAGWPTPNIGKFDSAPIAELCKLAFVVYRDDS
YLNAVTAMQAKPKTWNPVRLWTPYLAFDTAKKSSAEILSVRNAGLLVASIALMWISSTLF

Enzyme Prediction     

No EC number prediction in OON00529.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	89	387	4.4e-64	0.9713261648745519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	8.61e-38	94	386	11	269	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK66657.1|PL38	4.31e-52	31	418	23	379
ACU61970.1|PL38	1.56e-51	38	418	28	377
QMU30997.1|PL38	2.09e-50	4	443	9	410
QHS58483.1|PL38	4.32e-49	38	412	26	369
QIP15531.1|PL38	1.67e-48	39	417	29	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	2.57e-28	63	401	28	337	Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

OON00529.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000207	0.999789	CS pos: 21-22. Pr: 0.9794

TMHMM  Annotations     

There is no transmembrane helices in OON00529.1.